Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 454365..454947 | Replicon | chromosome |
| Accession | NZ_CP116571 | ||
| Organism | Enterococcus faecalis strain K190-1 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | A0A0M2AE74 |
| Locus tag | PML73_RS02395 | Protein ID | WP_002355414.1 |
| Coordinates | 454639..454947 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL19 |
| Locus tag | PML73_RS02390 | Protein ID | WP_002326825.1 |
| Coordinates | 454365..454637 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML73_RS02360 (449646) | 449646..450374 | - | 729 | WP_002355404.1 | GntR family transcriptional regulator | - |
| PML73_RS02365 (450551) | 450551..451477 | + | 927 | WP_002355406.1 | hypothetical protein | - |
| PML73_RS02370 (451494) | 451494..452777 | + | 1284 | WP_002363033.1 | PTS sugar transporter subunit IIC | - |
| PML73_RS02375 (452969) | 452969..453091 | + | 123 | Protein_443 | topoisomerase | - |
| PML73_RS02380 (453166) | 453166..454062 | + | 897 | WP_002363034.1 | ParA family protein | - |
| PML73_RS02385 (454139) | 454139..454348 | + | 210 | WP_002363035.1 | peptide-binding protein | - |
| PML73_RS02390 (454365) | 454365..454637 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
| PML73_RS02395 (454639) | 454639..454947 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
| PML73_RS02400 (455027) | 455027..455434 | - | 408 | WP_224571294.1 | tyrosine-type recombinase/integrase | - |
| PML73_RS02405 (455501) | 455501..456001 | - | 501 | WP_002363039.1 | HAD family hydrolase | - |
| PML73_RS02410 (456006) | 456006..456773 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PML73_RS02415 (457260) | 457260..457685 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
| PML73_RS02420 (457702) | 457702..458217 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
| PML73_RS02425 (458228) | 458228..459160 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T269000 WP_002355414.1 NZ_CP116571:454639-454947 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AE74 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AF93 |