Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 54347..54918 Replicon plasmid pK198-1-A
Accession NZ_CP116570
Organism Enterococcus faecalis strain K198-1

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag PML91_RS13245 Protein ID WP_002362432.1
Coordinates 54347..54688 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag PML91_RS13250 Protein ID WP_002362431.1
Coordinates 54688..54918 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PML91_RS13215 (PML91_13215) 49657..50337 - 681 WP_162781233.1 IS6-like element ISEnfa1 family transposase -
PML91_RS13220 (PML91_13220) 50690..50926 + 237 WP_002287931.1 addiction module antitoxin -
PML91_RS13225 (PML91_13225) 50923..51333 + 411 WP_104844818.1 type II toxin-antitoxin system death-on-curing family toxin -
PML91_RS13230 (PML91_13230) 51595..52128 - 534 WP_073340289.1 hypothetical protein -
PML91_RS13235 (PML91_13235) 52430..53032 - 603 WP_002362434.1 Fic family protein -
PML91_RS13240 (PML91_13240) 53297..54235 - 939 WP_002362433.1 hypothetical protein -
PML91_RS13245 (PML91_13245) 54347..54688 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PML91_RS13250 (PML91_13250) 54688..54918 - 231 WP_002362431.1 hypothetical protein Antitoxin
PML91_RS13255 (PML91_13255) 55122..55742 + 621 WP_013438829.1 recombinase family protein -
PML91_RS13260 (PML91_13260) 55759..56043 + 285 WP_002394798.1 hypothetical protein -
PML91_RS13265 (PML91_13265) 56045..56278 + 234 WP_002394799.1 hypothetical protein -
PML91_RS13270 (PML91_13270) 56438..56692 - 255 WP_002394800.1 hypothetical protein -
PML91_RS13275 (PML91_13275) 56809..57477 - 669 WP_002394801.1 CPBP family intramembrane metalloprotease -
PML91_RS13280 (PML91_13280) 57513..57830 - 318 WP_002394802.1 heavy metal-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(L) / tet(M) / optrA / fexA / erm(B) - 1..78685 78685
- flank IS/Tn - - 49657..50343 686


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T268998 WP_002362432.1 NZ_CP116570:c54688-54347 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT268998 WP_002362431.1 NZ_CP116570:c54918-54688 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References