Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 54347..54918 | Replicon | plasmid pK198-1-A |
| Accession | NZ_CP116570 | ||
| Organism | Enterococcus faecalis strain K198-1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2Z2CGM4 |
| Locus tag | PML91_RS13245 | Protein ID | WP_002362432.1 |
| Coordinates | 54347..54688 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | PML91_RS13250 | Protein ID | WP_002362431.1 |
| Coordinates | 54688..54918 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML91_RS13215 (PML91_13215) | 49657..50337 | - | 681 | WP_162781233.1 | IS6-like element ISEnfa1 family transposase | - |
| PML91_RS13220 (PML91_13220) | 50690..50926 | + | 237 | WP_002287931.1 | addiction module antitoxin | - |
| PML91_RS13225 (PML91_13225) | 50923..51333 | + | 411 | WP_104844818.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| PML91_RS13230 (PML91_13230) | 51595..52128 | - | 534 | WP_073340289.1 | hypothetical protein | - |
| PML91_RS13235 (PML91_13235) | 52430..53032 | - | 603 | WP_002362434.1 | Fic family protein | - |
| PML91_RS13240 (PML91_13240) | 53297..54235 | - | 939 | WP_002362433.1 | hypothetical protein | - |
| PML91_RS13245 (PML91_13245) | 54347..54688 | - | 342 | WP_002362432.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PML91_RS13250 (PML91_13250) | 54688..54918 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| PML91_RS13255 (PML91_13255) | 55122..55742 | + | 621 | WP_013438829.1 | recombinase family protein | - |
| PML91_RS13260 (PML91_13260) | 55759..56043 | + | 285 | WP_002394798.1 | hypothetical protein | - |
| PML91_RS13265 (PML91_13265) | 56045..56278 | + | 234 | WP_002394799.1 | hypothetical protein | - |
| PML91_RS13270 (PML91_13270) | 56438..56692 | - | 255 | WP_002394800.1 | hypothetical protein | - |
| PML91_RS13275 (PML91_13275) | 56809..57477 | - | 669 | WP_002394801.1 | CPBP family intramembrane metalloprotease | - |
| PML91_RS13280 (PML91_13280) | 57513..57830 | - | 318 | WP_002394802.1 | heavy metal-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(L) / tet(M) / optrA / fexA / erm(B) | - | 1..78685 | 78685 | |
| - | flank | IS/Tn | - | - | 49657..50343 | 686 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13244.44 Da Isoelectric Point: 8.0113
>T268998 WP_002362432.1 NZ_CP116570:c54688-54347 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2Z2CGM4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R3KHK9 |