Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2624136..2624707 | Replicon | chromosome |
| Accession | NZ_CP116569 | ||
| Organism | Enterococcus faecalis strain K198-1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PML91_RS12475 | Protein ID | WP_002354774.1 |
| Coordinates | 2624136..2624477 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | PML91_RS12480 | Protein ID | WP_002354773.1 |
| Coordinates | 2624477..2624707 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML91_RS12470 (2620151) | 2620151..2623765 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| PML91_RS12475 (2624136) | 2624136..2624477 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PML91_RS12480 (2624477) | 2624477..2624707 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| PML91_RS12485 (2625121) | 2625121..2625336 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| PML91_RS12490 (2625475) | 2625475..2626467 | + | 993 | WP_002354765.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| PML91_RS12495 (2626534) | 2626534..2627166 | - | 633 | WP_002358972.1 | RloB family protein | - |
| PML91_RS12500 (2627175) | 2627175..2628470 | - | 1296 | WP_176944748.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T268987 WP_002354774.1 NZ_CP116569:c2624477-2624136 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|