Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 63988..64559 Replicon plasmid pK191-1-A
Accession NZ_CP116567
Organism Enterococcus faecalis strain K191-1

Toxin (Protein)


Gene name mazF Uniprot ID A0A2P6BPI5
Locus tag PML79_RS13760 Protein ID WP_002394791.1
Coordinates 63988..64329 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag PML79_RS13765 Protein ID WP_002362431.1
Coordinates 64329..64559 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PML79_RS13740 (PML79_13740) 59831..60868 + 1038 WP_002355369.1 PTS sugar transporter subunit IIC -
PML79_RS13745 (PML79_13745) 61154..61834 + 681 WP_071621256.1 IS6 family transposase -
PML79_RS13750 (PML79_13750) 62068..62670 - 603 WP_002367780.1 Fic family protein -
PML79_RS13755 (PML79_13755) 62938..63876 - 939 WP_002394789.1 hypothetical protein -
PML79_RS13760 (PML79_13760) 63988..64329 - 342 WP_002394791.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PML79_RS13765 (PML79_13765) 64329..64559 - 231 WP_002362431.1 hypothetical protein Antitoxin
PML79_RS13770 (PML79_13770) 64763..65383 + 621 WP_002375379.1 recombinase family protein -
PML79_RS13775 (PML79_13775) 65400..65684 + 285 WP_010730209.1 hypothetical protein -
PML79_RS13780 (PML79_13780) 65681..65905 + 225 WP_002386516.1 hypothetical protein -
PML79_RS13785 (PML79_13785) 65993..66067 + 75 Protein_80 DNA helicase UvrB -
PML79_RS13790 (PML79_13790) 66272..66865 - 594 WP_002386518.1 TMEM175 family protein -
PML79_RS13795 (PML79_13795) 67026..68486 - 1461 WP_271866347.1 LPXTG cell wall anchor domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid tet(L) / tet(M) / erm(B) / aph(3')-III / dfrG / fexA / optrA / erm(A) bsh 1..74469 74469


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13248.49 Da        Isoelectric Point: 8.8595

>T268978 WP_002394791.1 NZ_CP116567:c64329-63988 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT268978 WP_002362431.1 NZ_CP116567:c64559-64329 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P6BPI5

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References