Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2673776..2674347 | Replicon | chromosome |
Accession | NZ_CP116566 | ||
Organism | Enterococcus faecalis strain K191-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | R3GRA7 |
Locus tag | PML79_RS12930 | Protein ID | WP_002360937.1 |
Coordinates | 2673776..2674117 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S4CGQ1 |
Locus tag | PML79_RS12935 | Protein ID | WP_002367500.1 |
Coordinates | 2674117..2674347 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML79_RS12925 (2669536) | 2669536..2673150 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
PML79_RS12930 (2673776) | 2673776..2674117 | - | 342 | WP_002360937.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PML79_RS12935 (2674117) | 2674117..2674347 | - | 231 | WP_002367500.1 | hypothetical protein | Antitoxin |
PML79_RS12940 (2674761) | 2674761..2674976 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
PML79_RS12945 (2675115) | 2675115..2676107 | + | 993 | WP_010776203.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
PML79_RS12950 (2676174) | 2676174..2676560 | - | 387 | WP_244323692.1 | RloB domain-containing protein | - |
PML79_RS12955 (2676512) | 2676512..2676790 | - | 279 | WP_253544428.1 | RloB family protein | - |
PML79_RS12960 (2676799) | 2676799..2678094 | - | 1296 | WP_010824051.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13165.41 Da Isoelectric Point: 9.3988
>T268974 WP_002360937.1 NZ_CP116566:c2674117-2673776 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2A7G9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S4CGQ1 |