Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 63988..64559 | Replicon | plasmid pK72-1-A |
| Accession | NZ_CP116562 | ||
| Organism | Enterococcus faecalis strain K72-1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2P6BPI5 |
| Locus tag | PML97_RS14135 | Protein ID | WP_002394791.1 |
| Coordinates | 63988..64329 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | PML97_RS14140 | Protein ID | WP_002362431.1 |
| Coordinates | 64329..64559 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML97_RS14115 (PML97_14115) | 59831..60868 | + | 1038 | WP_002355369.1 | PTS sugar transporter subunit IIC | - |
| PML97_RS14120 (PML97_14120) | 61154..61834 | + | 681 | WP_071621256.1 | IS6 family transposase | - |
| PML97_RS14125 (PML97_14125) | 62068..62670 | - | 603 | WP_002367780.1 | Fic family protein | - |
| PML97_RS14130 (PML97_14130) | 62938..63876 | - | 939 | WP_002394789.1 | hypothetical protein | - |
| PML97_RS14135 (PML97_14135) | 63988..64329 | - | 342 | WP_002394791.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PML97_RS14140 (PML97_14140) | 64329..64559 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| PML97_RS14145 (PML97_14145) | 64763..65383 | + | 621 | WP_002375379.1 | recombinase family protein | - |
| PML97_RS14150 (PML97_14150) | 65400..65684 | + | 285 | WP_010730209.1 | hypothetical protein | - |
| PML97_RS14155 (PML97_14155) | 65681..65905 | + | 225 | WP_002386516.1 | hypothetical protein | - |
| PML97_RS14160 (PML97_14160) | 65993..66067 | + | 75 | Protein_79 | DNA helicase UvrB | - |
| PML97_RS14165 (PML97_14165) | 66272..66865 | - | 594 | WP_002386518.1 | TMEM175 family protein | - |
| PML97_RS14170 (PML97_14170) | 67026..68486 | - | 1461 | WP_271866347.1 | LPXTG cell wall anchor domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | tet(L) / tet(M) / erm(B) / aph(3')-III / dfrG / fexA / optrA / erm(A) | bsh | 1..74469 | 74469 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13248.49 Da Isoelectric Point: 8.8595
>T268933 WP_002394791.1 NZ_CP116562:c64329-63988 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P6BPI5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R3KHK9 |