Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 21520..22657 | Replicon | plasmid pK72-1-A |
Accession | NZ_CP116562 | ||
Organism | Enterococcus faecalis strain K72-1 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | P0A4M2 |
Locus tag | PML97_RS13885 | Protein ID | WP_002332783.1 |
Coordinates | 21794..22657 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | PML97_RS13880 | Protein ID | WP_002326825.1 |
Coordinates | 21520..21792 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML97_RS13840 (PML97_13840) | 16536..16619 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
PML97_RS13845 (PML97_13845) | 16744..17481 | + | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
PML97_RS13850 (PML97_13850) | 17485..18279 | + | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
PML97_RS13855 (PML97_13855) | 18821..18904 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
PML97_RS13860 (PML97_13860) | 19029..19766 | + | 738 | WP_001038789.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
PML97_RS13865 (PML97_13865) | 19936..20196 | + | 261 | Protein_20 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
PML97_RS13870 (PML97_13870) | 20299..21195 | + | 897 | WP_002326827.1 | ParA family protein | - |
PML97_RS13875 (PML97_13875) | 21287..21502 | + | 216 | WP_001835296.1 | peptide-binding protein | - |
PML97_RS13880 (PML97_13880) | 21520..21792 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
PML97_RS13885 (PML97_13885) | 21794..22657 | + | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
PML97_RS13890 (PML97_13890) | 23097..23414 | + | 318 | WP_002326830.1 | hypothetical protein | - |
PML97_RS13895 (PML97_13895) | 23626..23910 | + | 285 | WP_000922261.1 | hypothetical protein | - |
PML97_RS13900 (PML97_13900) | 23917..25869 | + | 1953 | WP_000163792.1 | hypothetical protein | - |
PML97_RS13905 (PML97_13905) | 25941..26438 | - | 498 | WP_000868795.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | tet(L) / tet(M) / erm(B) / aph(3')-III / dfrG / fexA / optrA / erm(A) | bsh | 1..74469 | 74469 | |
- | flank | IS/Tn | erm(B) / aph(3')-III | - | 15275..19766 | 4491 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T268932 WP_002332783.1 NZ_CP116562:21794-22657 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P0A4M2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |