Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2722789..2723360 | Replicon | chromosome |
Accession | NZ_CP116561 | ||
Organism | Enterococcus faecalis strain K72-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | R3GRA7 |
Locus tag | PML97_RS13310 | Protein ID | WP_002360937.1 |
Coordinates | 2722789..2723130 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S4CGQ1 |
Locus tag | PML97_RS13315 | Protein ID | WP_002367500.1 |
Coordinates | 2723130..2723360 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML97_RS13305 (2718549) | 2718549..2722163 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
PML97_RS13310 (2722789) | 2722789..2723130 | - | 342 | WP_002360937.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PML97_RS13315 (2723130) | 2723130..2723360 | - | 231 | WP_002367500.1 | hypothetical protein | Antitoxin |
PML97_RS13320 (2723774) | 2723774..2723989 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
PML97_RS13325 (2724128) | 2724128..2725120 | + | 993 | WP_010776203.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
PML97_RS13330 (2725187) | 2725187..2725573 | - | 387 | WP_244323692.1 | RloB domain-containing protein | - |
PML97_RS13335 (2725525) | 2725525..2725803 | - | 279 | WP_253544428.1 | RloB family protein | - |
PML97_RS13340 (2725812) | 2725812..2727107 | - | 1296 | WP_010824051.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13165.41 Da Isoelectric Point: 9.3988
>T268929 WP_002360937.1 NZ_CP116561:c2723130-2722789 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2A7G9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S4CGQ1 |