Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 41725..42296 Replicon plasmid pK137-1a-A
Accession NZ_CP116560
Organism Enterococcus faecalis strain K137-1a

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag PML94_RS13235 Protein ID WP_002362432.1
Coordinates 41725..42066 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag PML94_RS13240 Protein ID WP_002362431.1
Coordinates 42066..42296 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PML94_RS13215 (PML94_13215) 37124..38407 - 1284 Protein_39 hypothetical protein -
PML94_RS13225 (PML94_13225) 39808..40410 - 603 WP_002362434.1 Fic family protein -
PML94_RS13230 (PML94_13230) 40675..41613 - 939 WP_002362433.1 hypothetical protein -
PML94_RS13235 (PML94_13235) 41725..42066 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PML94_RS13240 (PML94_13240) 42066..42296 - 231 WP_002362431.1 hypothetical protein Antitoxin
PML94_RS13245 (PML94_13245) 42500..43120 + 621 WP_002367784.1 recombinase family protein -
PML94_RS13250 (PML94_13250) 43110..43424 + 315 WP_002367785.1 hypothetical protein -
PML94_RS13255 (PML94_13255) 43418..43624 + 207 WP_002367786.1 hypothetical protein -
PML94_RS13260 (PML94_13260) 43784..43978 + 195 WP_002367787.1 hypothetical protein -
PML94_RS13265 (PML94_13265) 43990..44181 + 192 WP_002367788.1 hypothetical protein -
PML94_RS13270 (PML94_13270) 44351..44566 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
PML94_RS13275 (PML94_13275) 44567..44908 + 342 WP_002367792.1 bacteriocin immunity protein -
PML94_RS13280 (PML94_13280) 45324..45842 + 519 WP_002367793.1 hypothetical protein -
PML94_RS13285 (PML94_13285) 45790..46005 + 216 WP_002415356.1 hypothetical protein -
PML94_RS13290 (PML94_13290) 46097..46183 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
PML94_RS13295 (PML94_13295) 46440..46736 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / fexA / optrA / erm(B) - 1..51389 51389


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T268911 WP_002362432.1 NZ_CP116560:c42066-41725 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT268911 WP_002362431.1 NZ_CP116560:c42296-42066 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References