Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2652343..2652914 | Replicon | chromosome |
| Accession | NZ_CP116559 | ||
| Organism | Enterococcus faecalis strain K137-1a | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | R3GRA7 |
| Locus tag | PML94_RS12565 | Protein ID | WP_002360937.1 |
| Coordinates | 2652343..2652684 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | PML94_RS12570 | Protein ID | WP_002354773.1 |
| Coordinates | 2652684..2652914 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML94_RS12560 (2648358) | 2648358..2651972 | - | 3615 | WP_010712913.1 | DNA-directed RNA polymerase subunit beta | - |
| PML94_RS12565 (2652343) | 2652343..2652684 | - | 342 | WP_002360937.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PML94_RS12570 (2652684) | 2652684..2652914 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| PML94_RS12575 (2653088) | 2653088..2653303 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| PML94_RS12580 (2653442) | 2653442..2654434 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| PML94_RS12585 (2654738) | 2654738..2655376 | - | 639 | WP_002375448.1 | lytic polysaccharide monooxygenase | - |
| PML94_RS12590 (2656063) | 2656063..2657679 | + | 1617 | WP_002372620.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13165.41 Da Isoelectric Point: 9.3988
>T268907 WP_002360937.1 NZ_CP116559:c2652684-2652343 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2A7G9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2A812 |