Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 49946..50517 Replicon plasmid pK194-1-A
Accession NZ_CP116558
Organism Enterococcus faecalis strain K194-1

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag PML86_RS12995 Protein ID WP_002362432.1
Coordinates 49946..50287 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag PML86_RS13000 Protein ID WP_002362431.1
Coordinates 50287..50517 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PML86_RS12975 (PML86_12975) 45345..46628 - 1284 Protein_52 hypothetical protein -
PML86_RS12985 (PML86_12985) 48029..48631 - 603 WP_002362434.1 Fic family protein -
PML86_RS12990 (PML86_12990) 48896..49834 - 939 WP_002362433.1 hypothetical protein -
PML86_RS12995 (PML86_12995) 49946..50287 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PML86_RS13000 (PML86_13000) 50287..50517 - 231 WP_002362431.1 hypothetical protein Antitoxin
PML86_RS13005 (PML86_13005) 50721..51341 + 621 WP_002367784.1 recombinase family protein -
PML86_RS13010 (PML86_13010) 51331..51645 + 315 WP_002367785.1 hypothetical protein -
PML86_RS13015 (PML86_13015) 51639..51845 + 207 WP_002367786.1 hypothetical protein -
PML86_RS13020 (PML86_13020) 52005..52199 + 195 WP_002367787.1 hypothetical protein -
PML86_RS13025 (PML86_13025) 52211..52402 + 192 WP_002367788.1 hypothetical protein -
PML86_RS13030 (PML86_13030) 52572..52787 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
PML86_RS13035 (PML86_13035) 52788..53129 + 342 WP_002367792.1 bacteriocin immunity protein -
PML86_RS13040 (PML86_13040) 53545..54063 + 519 WP_002367793.1 hypothetical protein -
PML86_RS13045 (PML86_13045) 54011..54226 + 216 WP_002415356.1 hypothetical protein -
PML86_RS13050 (PML86_13050) 54318..54404 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
PML86_RS13055 (PML86_13055) 54661..54957 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / fexA / optrA / erm(B) - 1..59610 59610


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T268895 WP_002362432.1 NZ_CP116558:c50287-49946 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT268895 WP_002362431.1 NZ_CP116558:c50517-50287 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References