Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 49946..50517 | Replicon | plasmid pK194-1-A |
| Accession | NZ_CP116558 | ||
| Organism | Enterococcus faecalis strain K194-1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2Z2CGM4 |
| Locus tag | PML86_RS12995 | Protein ID | WP_002362432.1 |
| Coordinates | 49946..50287 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | PML86_RS13000 | Protein ID | WP_002362431.1 |
| Coordinates | 50287..50517 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML86_RS12975 (PML86_12975) | 45345..46628 | - | 1284 | Protein_52 | hypothetical protein | - |
| PML86_RS12985 (PML86_12985) | 48029..48631 | - | 603 | WP_002362434.1 | Fic family protein | - |
| PML86_RS12990 (PML86_12990) | 48896..49834 | - | 939 | WP_002362433.1 | hypothetical protein | - |
| PML86_RS12995 (PML86_12995) | 49946..50287 | - | 342 | WP_002362432.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PML86_RS13000 (PML86_13000) | 50287..50517 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| PML86_RS13005 (PML86_13005) | 50721..51341 | + | 621 | WP_002367784.1 | recombinase family protein | - |
| PML86_RS13010 (PML86_13010) | 51331..51645 | + | 315 | WP_002367785.1 | hypothetical protein | - |
| PML86_RS13015 (PML86_13015) | 51639..51845 | + | 207 | WP_002367786.1 | hypothetical protein | - |
| PML86_RS13020 (PML86_13020) | 52005..52199 | + | 195 | WP_002367787.1 | hypothetical protein | - |
| PML86_RS13025 (PML86_13025) | 52211..52402 | + | 192 | WP_002367788.1 | hypothetical protein | - |
| PML86_RS13030 (PML86_13030) | 52572..52787 | + | 216 | WP_002367791.1 | leucocin A/sakacin P family class II bacteriocin | - |
| PML86_RS13035 (PML86_13035) | 52788..53129 | + | 342 | WP_002367792.1 | bacteriocin immunity protein | - |
| PML86_RS13040 (PML86_13040) | 53545..54063 | + | 519 | WP_002367793.1 | hypothetical protein | - |
| PML86_RS13045 (PML86_13045) | 54011..54226 | + | 216 | WP_002415356.1 | hypothetical protein | - |
| PML86_RS13050 (PML86_13050) | 54318..54404 | + | 87 | WP_012881081.1 | type I toxin-antitoxin system Fst family toxin | - |
| PML86_RS13055 (PML86_13055) | 54661..54957 | + | 297 | WP_002367795.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | cat / tet(L) / tet(M) / fexA / optrA / erm(B) | - | 1..59610 | 59610 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13244.44 Da Isoelectric Point: 8.0113
>T268895 WP_002362432.1 NZ_CP116558:c50287-49946 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2Z2CGM4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R3KHK9 |