Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 49501..50072 | Replicon | plasmid pK70-12a-A |
| Accession | NZ_CP116556 | ||
| Organism | Enterococcus faecalis strain K70-12a | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2Z2CGM4 |
| Locus tag | PML75_RS13300 | Protein ID | WP_002362432.1 |
| Coordinates | 49501..49842 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | PML75_RS13305 | Protein ID | WP_002362431.1 |
| Coordinates | 49842..50072 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML75_RS13280 (PML75_13280) | 44900..46183 | - | 1284 | Protein_51 | hypothetical protein | - |
| PML75_RS13290 (PML75_13290) | 47584..48186 | - | 603 | WP_002362434.1 | Fic family protein | - |
| PML75_RS13295 (PML75_13295) | 48451..49389 | - | 939 | WP_002362433.1 | hypothetical protein | - |
| PML75_RS13300 (PML75_13300) | 49501..49842 | - | 342 | WP_002362432.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PML75_RS13305 (PML75_13305) | 49842..50072 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| PML75_RS13310 (PML75_13310) | 50276..50896 | + | 621 | WP_002367784.1 | recombinase family protein | - |
| PML75_RS13315 (PML75_13315) | 50886..51200 | + | 315 | WP_002367785.1 | hypothetical protein | - |
| PML75_RS13320 (PML75_13320) | 51194..51400 | + | 207 | WP_002367786.1 | hypothetical protein | - |
| PML75_RS13325 (PML75_13325) | 51560..51754 | + | 195 | WP_002367787.1 | hypothetical protein | - |
| PML75_RS13330 (PML75_13330) | 51766..51957 | + | 192 | WP_002367788.1 | hypothetical protein | - |
| PML75_RS13335 (PML75_13335) | 52127..52342 | + | 216 | WP_002367791.1 | leucocin A/sakacin P family class II bacteriocin | - |
| PML75_RS13340 (PML75_13340) | 52343..52684 | + | 342 | WP_002367792.1 | bacteriocin immunity protein | - |
| PML75_RS13345 (PML75_13345) | 53100..53618 | + | 519 | WP_002367793.1 | hypothetical protein | - |
| PML75_RS13350 (PML75_13350) | 53566..53781 | + | 216 | WP_002415356.1 | hypothetical protein | - |
| PML75_RS13355 (PML75_13355) | 53873..53959 | + | 87 | WP_012881081.1 | type I toxin-antitoxin system Fst family toxin | - |
| PML75_RS13360 (PML75_13360) | 54216..54512 | + | 297 | WP_002367795.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | cat / tet(L) / tet(M) / fexA / optrA / erm(B) | - | 1..59165 | 59165 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13244.44 Da Isoelectric Point: 8.0113
>T268879 WP_002362432.1 NZ_CP116556:c49842-49501 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2Z2CGM4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R3KHK9 |