268879

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 49501..50072 Replicon plasmid pK70-12a-A
Accession NZ_CP116556
Organism Enterococcus faecalis strain K70-12a

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag PML75_RS13300 Protein ID WP_002362432.1
Coordinates 49501..49842 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag PML75_RS13305 Protein ID WP_002362431.1
Coordinates 49842..50072 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PML75_RS13280 (PML75_13280) 44900..46183 - 1284 Protein_51 hypothetical protein -
PML75_RS13290 (PML75_13290) 47584..48186 - 603 WP_002362434.1 Fic family protein -
PML75_RS13295 (PML75_13295) 48451..49389 - 939 WP_002362433.1 hypothetical protein -
PML75_RS13300 (PML75_13300) 49501..49842 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PML75_RS13305 (PML75_13305) 49842..50072 - 231 WP_002362431.1 hypothetical protein Antitoxin
PML75_RS13310 (PML75_13310) 50276..50896 + 621 WP_002367784.1 recombinase family protein -
PML75_RS13315 (PML75_13315) 50886..51200 + 315 WP_002367785.1 hypothetical protein -
PML75_RS13320 (PML75_13320) 51194..51400 + 207 WP_002367786.1 hypothetical protein -
PML75_RS13325 (PML75_13325) 51560..51754 + 195 WP_002367787.1 hypothetical protein -
PML75_RS13330 (PML75_13330) 51766..51957 + 192 WP_002367788.1 hypothetical protein -
PML75_RS13335 (PML75_13335) 52127..52342 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
PML75_RS13340 (PML75_13340) 52343..52684 + 342 WP_002367792.1 bacteriocin immunity protein -
PML75_RS13345 (PML75_13345) 53100..53618 + 519 WP_002367793.1 hypothetical protein -
PML75_RS13350 (PML75_13350) 53566..53781 + 216 WP_002415356.1 hypothetical protein -
PML75_RS13355 (PML75_13355) 53873..53959 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
PML75_RS13360 (PML75_13360) 54216..54512 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / fexA / optrA / erm(B) - 1..59165 59165


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T268879 WP_002362432.1 NZ_CP116556:c49842-49501 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT268879 WP_002362431.1 NZ_CP116556:c50072-49842 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References