Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 31313..32450 | Replicon | plasmid pK80-15b-B |
Accession | NZ_CP116551 | ||
Organism | Enterococcus faecium strain K80-15b |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | PML85_RS13925 | Protein ID | WP_010717401.1 |
Coordinates | 31587..32450 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | PML85_RS13920 | Protein ID | WP_000301765.1 |
Coordinates | 31313..31585 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML85_RS13890 (PML85_13890) | 28297..28536 | + | 240 | WP_002425012.1 | peptide-binding protein | - |
PML85_RS13895 (PML85_13895) | 28585..28680 | + | 96 | WP_001809736.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
PML85_RS13900 (PML85_13900) | 28844..29581 | + | 738 | WP_010725603.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
PML85_RS13905 (PML85_13905) | 29751..30011 | + | 261 | Protein_31 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
PML85_RS13910 (PML85_13910) | 30114..31010 | + | 897 | WP_272019756.1 | ParA family protein | - |
PML85_RS13915 (PML85_13915) | 31081..31296 | + | 216 | WP_002295735.1 | peptide-binding protein | - |
PML85_RS13920 (PML85_13920) | 31313..31585 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
PML85_RS13925 (PML85_13925) | 31587..32450 | + | 864 | WP_010717401.1 | zeta toxin family protein | Toxin |
PML85_RS13930 (PML85_13930) | 32891..33208 | + | 318 | WP_002300567.1 | hypothetical protein | - |
PML85_RS13935 (PML85_13935) | 33741..34238 | + | 498 | WP_115253289.1 | molecular chaperone DnaJ | - |
PML85_RS13940 (PML85_13940) | 34273..34596 | + | 324 | WP_047342412.1 | DpnD/PcfM family protein | - |
PML85_RS13945 (PML85_13945) | 34625..34882 | - | 258 | WP_202243043.1 | hypothetical protein | - |
PML85_RS13950 (PML85_13950) | 34885..35184 | - | 300 | WP_002325624.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | erm(B) | - | 1..41241 | 41241 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32521.11 Da Isoelectric Point: 6.9965
>T268847 WP_010717401.1 NZ_CP116551:31587-32450 [Enterococcus faecium]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEVIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLRPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEVIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLRPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|