Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 508945..509516 | Replicon | chromosome |
Accession | NZ_CP116549 | ||
Organism | Enterococcus faecium strain K80-15b |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q3Y2B8 |
Locus tag | PML85_RS02435 | Protein ID | WP_002286801.1 |
Coordinates | 509175..509516 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | PML85_RS02430 | Protein ID | WP_002323011.1 |
Coordinates | 508945..509175 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML85_RS02405 (PML85_02405) | 504078..505409 | + | 1332 | WP_002286818.1 | FAD-containing oxidoreductase | - |
PML85_RS02410 (PML85_02410) | 505431..506057 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
PML85_RS02415 (PML85_02415) | 506240..506821 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
PML85_RS02420 (PML85_02420) | 507553..508115 | + | 563 | Protein_480 | SOS response-associated peptidase family protein | - |
PML85_RS02425 (PML85_02425) | 508320..508658 | - | 339 | WP_002286804.1 | hypothetical protein | - |
PML85_RS02430 (PML85_02430) | 508945..509175 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
PML85_RS02435 (PML85_02435) | 509175..509516 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PML85_RS02440 (PML85_02440) | 510366..510551 | + | 186 | WP_002304207.1 | hypothetical protein | - |
PML85_RS02445 (PML85_02445) | 511056..511250 | + | 195 | WP_002297028.1 | hypothetical protein | - |
PML85_RS02450 (PML85_02450) | 511441..511690 | + | 250 | Protein_486 | transposase | - |
PML85_RS02455 (PML85_02455) | 511934..512764 | - | 831 | WP_002286789.1 | manganese catalase family protein | - |
PML85_RS02460 (PML85_02460) | 512972..514306 | + | 1335 | WP_002286788.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T268845 WP_002286801.1 NZ_CP116549:509175-509516 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FD66 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZZN9 |