Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 507230..507801 | Replicon | chromosome |
| Accession | NZ_CP116546 | ||
| Organism | Enterococcus faecium strain K189-3 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q3Y2B8 |
| Locus tag | PML74_RS02425 | Protein ID | WP_002286801.1 |
| Coordinates | 507460..507801 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | PML74_RS02420 | Protein ID | WP_002323011.1 |
| Coordinates | 507230..507460 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML74_RS02395 (PML74_02395) | 502363..503694 | + | 1332 | WP_002286818.1 | FAD-containing oxidoreductase | - |
| PML74_RS02400 (PML74_02400) | 503716..504342 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
| PML74_RS02405 (PML74_02405) | 504525..505106 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
| PML74_RS02410 (PML74_02410) | 505838..506400 | + | 563 | Protein_478 | SOS response-associated peptidase family protein | - |
| PML74_RS02415 (PML74_02415) | 506605..506943 | - | 339 | WP_002286804.1 | hypothetical protein | - |
| PML74_RS02420 (PML74_02420) | 507230..507460 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| PML74_RS02425 (PML74_02425) | 507460..507801 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PML74_RS02430 (PML74_02430) | 508651..508836 | + | 186 | WP_002304207.1 | hypothetical protein | - |
| PML74_RS02435 (PML74_02435) | 509341..509535 | + | 195 | WP_002297028.1 | hypothetical protein | - |
| PML74_RS02440 (PML74_02440) | 509726..509975 | + | 250 | Protein_484 | transposase | - |
| PML74_RS02445 (PML74_02445) | 510219..511049 | - | 831 | WP_002286789.1 | manganese catalase family protein | - |
| PML74_RS02450 (PML74_02450) | 511257..512591 | + | 1335 | WP_002286788.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T268842 WP_002286801.1 NZ_CP116546:507460-507801 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FD66 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZZN9 |