Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 73057..74165 | Replicon | plasmid pK70-1a-A |
Accession | NZ_CP116544 | ||
Organism | Enterococcus faecium strain K70-1a |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | A0A3S8RBH6 |
Locus tag | PML99_RS13675 | Protein ID | WP_071661597.1 |
Coordinates | 73057..73926 (-) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | PML99_RS13680 | Protein ID | WP_000205227.1 |
Coordinates | 73941..74165 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML99_RS13645 (PML99_13645) | 68842..69384 | - | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
PML99_RS13650 (PML99_13650) | 69381..70178 | - | 798 | Protein_81 | aminoglycoside 6-adenylyltransferase | - |
PML99_RS13655 (PML99_13655) | 70348..71787 | - | 1440 | WP_001028144.1 | aminoglycoside O-phosphotransferase APH(2'')-Ia | - |
PML99_RS13660 (PML99_13660) | 71788..72180 | - | 393 | WP_000393259.1 | GNAT family N-acetyltransferase | - |
PML99_RS13665 (PML99_13665) | 72199..72309 | - | 111 | Protein_84 | aminoglycoside 6-adenylyltransferase | - |
PML99_RS13670 (PML99_13670) | 72342..73076 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
PML99_RS13675 (PML99_13675) | 73057..73926 | - | 870 | WP_071661597.1 | nucleotidyltransferase domain-containing protein | Toxin |
PML99_RS13680 (PML99_13680) | 73941..74165 | - | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PML99_RS13685 (PML99_13685) | 74583..75884 | + | 1302 | Protein_88 | ISL3 family transposase | - |
PML99_RS13690 (PML99_13690) | 76193..76996 | - | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
PML99_RS13695 (PML99_13695) | 77050..78534 | - | 1485 | WP_002294513.1 | ABC-F type ribosomal protection protein Lsa(E) | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32902.55 Da Isoelectric Point: 4.9770
>T268840 WP_071661597.1 NZ_CP116544:c73926-73057 [Enterococcus faecium]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEHKPEKYTE
KVNHIFEVLGISLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEHKPEKYTE
KVNHIFEVLGISLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|