Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 509400..509971 | Replicon | chromosome |
| Accession | NZ_CP116540 | ||
| Organism | Enterococcus faecium strain K75-1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q3Y2B8 |
| Locus tag | PML93_RS02435 | Protein ID | WP_002286801.1 |
| Coordinates | 509630..509971 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | PML93_RS02430 | Protein ID | WP_002323011.1 |
| Coordinates | 509400..509630 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML93_RS02405 (PML93_02405) | 504533..505864 | + | 1332 | WP_002286818.1 | FAD-containing oxidoreductase | - |
| PML93_RS02410 (PML93_02410) | 505886..506512 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
| PML93_RS02415 (PML93_02415) | 506695..507276 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
| PML93_RS02420 (PML93_02420) | 508008..508570 | + | 563 | Protein_480 | SOS response-associated peptidase family protein | - |
| PML93_RS02425 (PML93_02425) | 508775..509113 | - | 339 | WP_002286804.1 | hypothetical protein | - |
| PML93_RS02430 (PML93_02430) | 509400..509630 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| PML93_RS02435 (PML93_02435) | 509630..509971 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PML93_RS02440 (PML93_02440) | 510821..511006 | + | 186 | WP_002304207.1 | hypothetical protein | - |
| PML93_RS02445 (PML93_02445) | 511511..511705 | + | 195 | WP_002297028.1 | hypothetical protein | - |
| PML93_RS02450 (PML93_02450) | 511896..512145 | + | 250 | Protein_486 | transposase | - |
| PML93_RS02455 (PML93_02455) | 512389..513219 | - | 831 | WP_002286789.1 | manganese catalase family protein | - |
| PML93_RS02460 (PML93_02460) | 513427..514761 | + | 1335 | WP_002286788.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T268836 WP_002286801.1 NZ_CP116540:509630-509971 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FD66 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZZN9 |