Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 516850..517421 | Replicon | chromosome |
| Accession | NZ_CP116536 | ||
| Organism | Enterococcus faecium strain K162-1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A8B2RQB5 |
| Locus tag | PML70_RS02470 | Protein ID | WP_002349927.1 |
| Coordinates | 517080..517421 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A854KBC5 |
| Locus tag | PML70_RS02465 | Protein ID | WP_010728130.1 |
| Coordinates | 516850..517080 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML70_RS02440 (PML70_02440) | 512074..513405 | + | 1332 | WP_002300334.1 | FAD-containing oxidoreductase | - |
| PML70_RS02445 (PML70_02445) | 513427..514053 | + | 627 | WP_002300333.1 | cysteine hydrolase | - |
| PML70_RS02450 (PML70_02450) | 514246..514827 | + | 582 | WP_002300332.1 | TetR/AcrR family transcriptional regulator | - |
| PML70_RS02455 (PML70_02455) | 515436..516011 | + | 576 | WP_002349929.1 | SOS response-associated peptidase family protein | - |
| PML70_RS02460 (PML70_02460) | 516216..516554 | - | 339 | WP_002286804.1 | hypothetical protein | - |
| PML70_RS02465 (PML70_02465) | 516850..517080 | + | 231 | WP_010728130.1 | hypothetical protein | Antitoxin |
| PML70_RS02470 (PML70_02470) | 517080..517421 | + | 342 | WP_002349927.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PML70_RS02475 (PML70_02475) | 518270..518455 | + | 186 | WP_002304207.1 | hypothetical protein | - |
| PML70_RS02480 (PML70_02480) | 518960..519154 | + | 195 | WP_002295146.1 | hypothetical protein | - |
| PML70_RS02485 (PML70_02485) | 519345..519594 | + | 250 | Protein_493 | transposase | - |
| PML70_RS02490 (PML70_02490) | 519838..520668 | - | 831 | WP_002286789.1 | manganese catalase family protein | - |
| PML70_RS02495 (PML70_02495) | 520876..522210 | + | 1335 | WP_002286788.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13216.59 Da Isoelectric Point: 10.0749
>T268832 WP_002349927.1 NZ_CP116536:517080-517421 [Enterococcus faecium]
VSGERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSGERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B2RQB5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A854KBC5 |