Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 479517..480088 | Replicon | chromosome |
Accession | NZ_CP116532 | ||
Organism | Enterococcus faecium strain K191-3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q3Y2B8 |
Locus tag | PML76_RS02290 | Protein ID | WP_002286801.1 |
Coordinates | 479747..480088 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | PML76_RS02285 | Protein ID | WP_002323011.1 |
Coordinates | 479517..479747 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML76_RS02260 (PML76_02260) | 474884..476215 | + | 1332 | WP_002330022.1 | FAD-containing oxidoreductase | - |
PML76_RS02265 (PML76_02265) | 476237..476863 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
PML76_RS02270 (PML76_02270) | 477046..477627 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
PML76_RS02275 (PML76_02275) | 478112..478687 | + | 576 | WP_002293673.1 | SOS response-associated peptidase family protein | - |
PML76_RS02280 (PML76_02280) | 478892..479230 | - | 339 | WP_002286804.1 | hypothetical protein | - |
PML76_RS02285 (PML76_02285) | 479517..479747 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
PML76_RS02290 (PML76_02290) | 479747..480088 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PML76_RS02295 (PML76_02295) | 480938..481123 | + | 186 | WP_002304207.1 | hypothetical protein | - |
PML76_RS02300 (PML76_02300) | 481393..482555 | + | 1163 | WP_086956687.1 | IS3 family transposase | - |
PML76_RS02305 (PML76_02305) | 482686..482928 | + | 243 | Protein_457 | LPXTG cell wall anchor domain-containing protein | - |
PML76_RS02310 (PML76_02310) | 483002..483895 | + | 894 | WP_002286772.1 | class C sortase | - |
PML76_RS02315 (PML76_02315) | 484079..484753 | + | 675 | WP_002286771.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T268830 WP_002286801.1 NZ_CP116532:479747-480088 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FD66 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZZN9 |