Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 479513..480084 | Replicon | chromosome |
| Accession | NZ_CP116528 | ||
| Organism | Enterococcus faecium strain K188-5 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q3Y2B8 |
| Locus tag | PML77_RS02280 | Protein ID | WP_002286801.1 |
| Coordinates | 479743..480084 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | PML77_RS02275 | Protein ID | WP_002323011.1 |
| Coordinates | 479513..479743 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML77_RS02250 (PML77_02250) | 474880..476211 | + | 1332 | WP_002330022.1 | FAD-containing oxidoreductase | - |
| PML77_RS02255 (PML77_02255) | 476233..476859 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
| PML77_RS02260 (PML77_02260) | 477042..477623 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
| PML77_RS02265 (PML77_02265) | 478108..478683 | + | 576 | WP_002293673.1 | SOS response-associated peptidase family protein | - |
| PML77_RS02270 (PML77_02270) | 478888..479226 | - | 339 | WP_002286804.1 | hypothetical protein | - |
| PML77_RS02275 (PML77_02275) | 479513..479743 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| PML77_RS02280 (PML77_02280) | 479743..480084 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PML77_RS02285 (PML77_02285) | 480934..481119 | + | 186 | WP_002304207.1 | hypothetical protein | - |
| PML77_RS02290 (PML77_02290) | 481389..482551 | + | 1163 | WP_086956687.1 | IS3 family transposase | - |
| PML77_RS02295 (PML77_02295) | 482682..482924 | + | 243 | Protein_455 | LPXTG cell wall anchor domain-containing protein | - |
| PML77_RS02300 (PML77_02300) | 482998..483891 | + | 894 | WP_002286772.1 | class C sortase | - |
| PML77_RS02305 (PML77_02305) | 484075..484749 | + | 675 | WP_002286771.1 | response regulator transcription factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T268828 WP_002286801.1 NZ_CP116528:479743-480084 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FD66 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZZN9 |