Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 28542..29149 | Replicon | plasmid pK69-1a-B |
| Accession | NZ_CP116525 | ||
| Organism | Enterococcus faecium strain K69-1a | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | E3USU0 |
| Locus tag | PML71_RS13955 | Protein ID | WP_002321032.1 |
| Coordinates | 28799..29149 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A829F3C0 |
| Locus tag | PML71_RS13950 | Protein ID | WP_002287514.1 |
| Coordinates | 28542..28805 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML71_RS13910 (PML71_13910) | 23586..23846 | + | 261 | WP_002296240.1 | hypothetical protein | - |
| PML71_RS13915 (PML71_13915) | 24291..24497 | + | 207 | WP_002325537.1 | hypothetical protein | - |
| PML71_RS13920 (PML71_13920) | 24518..24748 | + | 231 | WP_010726736.1 | hypothetical protein | - |
| PML71_RS13925 (PML71_13925) | 24764..25201 | + | 438 | WP_002332738.1 | hypothetical protein | - |
| PML71_RS13930 (PML71_13930) | 25194..25901 | + | 708 | WP_002332739.1 | hypothetical protein | - |
| PML71_RS13935 (PML71_13935) | 26281..26460 | + | 180 | WP_002305761.1 | hypothetical protein | - |
| PML71_RS13940 (PML71_13940) | 26736..27140 | + | 405 | WP_002287522.1 | IS200/IS605-like element ISEfa4 family transposase | - |
| PML71_RS13945 (PML71_13945) | 27157..28305 | + | 1149 | WP_002287525.1 | IS200/IS605 family element RNA-guided endonuclease TnpB | - |
| PML71_RS13950 (PML71_13950) | 28542..28805 | + | 264 | WP_002287514.1 | hypothetical protein | Antitoxin |
| PML71_RS13955 (PML71_13955) | 28799..29149 | + | 351 | WP_002321032.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PML71_RS13960 (PML71_13960) | 29173..29787 | - | 615 | WP_002318230.1 | recombinase family protein | - |
| PML71_RS13965 (PML71_13965) | 30237..31562 | + | 1326 | WP_272019448.1 | Y-family DNA polymerase | - |
| PML71_RS13970 (PML71_13970) | 31555..31905 | + | 351 | WP_002323028.1 | hypothetical protein | - |
| PML71_RS13975 (PML71_13975) | 32121..32414 | + | 294 | WP_002326890.1 | hypothetical protein | - |
| PML71_RS13980 (PML71_13980) | 32734..33576 | + | 843 | WP_002323027.1 | ParA family protein | - |
| PML71_RS13985 (PML71_13985) | 33579..34133 | + | 555 | WP_002323026.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..57016 | 57016 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13255.28 Da Isoelectric Point: 8.0280
>T268826 WP_002321032.1 NZ_CP116525:28799-29149 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829F5H8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829F3C0 |