Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 28542..29149 Replicon plasmid pK69-1a-B
Accession NZ_CP116525
Organism Enterococcus faecium strain K69-1a

Toxin (Protein)


Gene name mazF Uniprot ID E3USU0
Locus tag PML71_RS13955 Protein ID WP_002321032.1
Coordinates 28799..29149 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A829F3C0
Locus tag PML71_RS13950 Protein ID WP_002287514.1
Coordinates 28542..28805 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PML71_RS13910 (PML71_13910) 23586..23846 + 261 WP_002296240.1 hypothetical protein -
PML71_RS13915 (PML71_13915) 24291..24497 + 207 WP_002325537.1 hypothetical protein -
PML71_RS13920 (PML71_13920) 24518..24748 + 231 WP_010726736.1 hypothetical protein -
PML71_RS13925 (PML71_13925) 24764..25201 + 438 WP_002332738.1 hypothetical protein -
PML71_RS13930 (PML71_13930) 25194..25901 + 708 WP_002332739.1 hypothetical protein -
PML71_RS13935 (PML71_13935) 26281..26460 + 180 WP_002305761.1 hypothetical protein -
PML71_RS13940 (PML71_13940) 26736..27140 + 405 WP_002287522.1 IS200/IS605-like element ISEfa4 family transposase -
PML71_RS13945 (PML71_13945) 27157..28305 + 1149 WP_002287525.1 IS200/IS605 family element RNA-guided endonuclease TnpB -
PML71_RS13950 (PML71_13950) 28542..28805 + 264 WP_002287514.1 hypothetical protein Antitoxin
PML71_RS13955 (PML71_13955) 28799..29149 + 351 WP_002321032.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PML71_RS13960 (PML71_13960) 29173..29787 - 615 WP_002318230.1 recombinase family protein -
PML71_RS13965 (PML71_13965) 30237..31562 + 1326 WP_272019448.1 Y-family DNA polymerase -
PML71_RS13970 (PML71_13970) 31555..31905 + 351 WP_002323028.1 hypothetical protein -
PML71_RS13975 (PML71_13975) 32121..32414 + 294 WP_002326890.1 hypothetical protein -
PML71_RS13980 (PML71_13980) 32734..33576 + 843 WP_002323027.1 ParA family protein -
PML71_RS13985 (PML71_13985) 33579..34133 + 555 WP_002323026.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..57016 57016


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(4-87)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13255.28 Da        Isoelectric Point: 8.0280

>T268826 WP_002321032.1 NZ_CP116525:28799-29149 [Enterococcus faecium]
MVRKPRQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVTVAPISSTTRNYPLYVNINSEYEMKTTGKVLLDQLT
TIDYEARECIFLEKAHDSLVEELLMKVRTVFQKVSK

Download         Length: 351 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 10183.60 Da        Isoelectric Point: 4.6865

>AT268826 WP_002287514.1 NZ_CP116525:28542-28805 [Enterococcus faecium]
MEMLPIKKWGNSNGLRLPKYIMEYLGIHTEDKVKIIQEEVNGQKRLIIEAANIENELTIEQLFENYTDERNHVTIQNLGE
AVGNEKW

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F5H8

Antitoxin

Source ID Structure
AlphaFold DB A0A829F3C0

References