Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 75436..76007 | Replicon | plasmid pR39-1-A |
| Accession | NZ_CP116518 | ||
| Organism | Enterococcus faecium strain R39-1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PML88_RS12650 | Protein ID | WP_002322675.1 |
| Coordinates | 75666..76007 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | PML88_RS12645 | Protein ID | WP_002322676.1 |
| Coordinates | 75436..75666 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML88_RS12620 (PML88_12620) | 70508..71062 | - | 555 | WP_002295761.1 | tyrosine-type recombinase/integrase | - |
| PML88_RS12625 (PML88_12625) | 71805..72347 | + | 543 | Protein_76 | PHP domain-containing protein | - |
| PML88_RS12630 (PML88_12630) | 72398..73210 | - | 813 | WP_002322679.1 | AAA family ATPase | - |
| PML88_RS12635 (PML88_12635) | 73203..74639 | - | 1437 | WP_002322678.1 | Mu transposase C-terminal domain-containing protein | - |
| PML88_RS12640 (PML88_12640) | 74611..75204 | - | 594 | WP_002322677.1 | recombinase family protein | - |
| PML88_RS12645 (PML88_12645) | 75436..75666 | + | 231 | WP_002322676.1 | hypothetical protein | Antitoxin |
| PML88_RS12650 (PML88_12650) | 75666..76007 | + | 342 | WP_002322675.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PML88_RS12655 (PML88_12655) | 76221..77723 | - | 1503 | WP_002322674.1 | xylulokinase | - |
| PML88_RS12660 (PML88_12660) | 77796..78848 | - | 1053 | WP_002323515.1 | sugar ABC transporter substrate-binding protein | - |
| PML88_RS12665 (PML88_12665) | 78901..79869 | - | 969 | WP_002322672.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..122895 | 122895 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13232.43 Da Isoelectric Point: 9.4128
>T268821 WP_002322675.1 NZ_CP116518:75666-76007 [Enterococcus faecium]
MTEEKNYIPKKGDIVWIDFDPSAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIRNFPTRYSLPTELDTTGQILISQ
LKSLDFNERKLKKIESLPLQDMAKIDQMIEYIF
MTEEKNYIPKKGDIVWIDFDPSAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIRNFPTRYSLPTELDTTGQILISQ
LKSLDFNERKLKKIESLPLQDMAKIDQMIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|