Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 485205..485776 | Replicon | chromosome |
Accession | NZ_CP116517 | ||
Organism | Enterococcus faecium strain R39-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PML88_RS02290 | Protein ID | WP_224450759.1 |
Coordinates | 485435..485776 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | PML88_RS02285 | Protein ID | WP_002323011.1 |
Coordinates | 485205..485435 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML88_RS02260 (PML88_02260) | 480682..482013 | + | 1332 | WP_002300334.1 | FAD-containing oxidoreductase | - |
PML88_RS02265 (PML88_02265) | 482035..482661 | + | 627 | WP_002300333.1 | cysteine hydrolase | - |
PML88_RS02270 (PML88_02270) | 482854..483435 | + | 582 | WP_002300332.1 | TetR/AcrR family transcriptional regulator | - |
PML88_RS02275 (PML88_02275) | 483799..484374 | + | 576 | WP_002302305.1 | SOS response-associated peptidase family protein | - |
PML88_RS02280 (PML88_02280) | 484579..484917 | - | 339 | WP_002286804.1 | hypothetical protein | - |
PML88_RS02285 (PML88_02285) | 485205..485435 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
PML88_RS02290 (PML88_02290) | 485435..485776 | + | 342 | WP_224450759.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PML88_RS02300 (PML88_02300) | 488242..490745 | + | 2504 | Protein_456 | SpaA isopeptide-forming pilin-related protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13230.61 Da Isoelectric Point: 10.0749
>T268820 WP_224450759.1 NZ_CP116517:485435-485776 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQGMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQGMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|