Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 492022..492593 | Replicon | chromosome |
| Accession | NZ_CP116514 | ||
| Organism | Enterococcus faecium strain K195-6b | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PML82_RS02360 | Protein ID | WP_131773576.1 |
| Coordinates | 492252..492593 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | PML82_RS02355 | Protein ID | WP_002323011.1 |
| Coordinates | 492022..492252 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PML82_RS02330 (PML82_02330) | 487377..488708 | + | 1332 | WP_002300334.1 | FAD-containing oxidoreductase | - |
| PML82_RS02335 (PML82_02335) | 488730..489356 | + | 627 | WP_002300333.1 | cysteine hydrolase | - |
| PML82_RS02340 (PML82_02340) | 489549..490130 | + | 582 | WP_002300332.1 | TetR/AcrR family transcriptional regulator | - |
| PML82_RS02345 (PML82_02345) | 490616..491191 | + | 576 | WP_002302305.1 | SOS response-associated peptidase family protein | - |
| PML82_RS02350 (PML82_02350) | 491396..491734 | - | 339 | WP_002286804.1 | hypothetical protein | - |
| PML82_RS02355 (PML82_02355) | 492022..492252 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| PML82_RS02360 (PML82_02360) | 492252..492593 | + | 342 | WP_131773576.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PML82_RS02365 (PML82_02365) | 493443..493628 | + | 186 | WP_002325132.1 | hypothetical protein | - |
| PML82_RS02370 (PML82_02370) | 494133..494312 | + | 180 | WP_131773577.1 | hypothetical protein | - |
| PML82_RS02375 (PML82_02375) | 494316..495275 | - | 960 | WP_002301399.1 | IS30 family transposase | - |
| PML82_RS02380 (PML82_02380) | 495396..497093 | + | 1698 | WP_002326336.1 | SpaH/EbpB family LPXTG-anchored major pilin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 494316..495275 | 959 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13287.67 Da Isoelectric Point: 10.0749
>T268818 WP_131773576.1 NZ_CP116514:492252-492593 [Enterococcus faecium]
VSEERIYIPKKGNIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGNIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|