Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 137..18136 | Replicon | plasmid pK205-4a-B |
Accession | NZ_CP116512 | ||
Organism | Enterococcus gallinarum strain K205-4a |
Toxin (Protein)
Gene name | zeta | Uniprot ID | Q54944 |
Locus tag | PML87_RS15145 | Protein ID | WP_001284311.1 |
Coordinates | 139..1002 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | PML87_RS15140 | Protein ID | WP_000301765.1 |
Coordinates | 18136..137 (+) | Length | -5999.3333333333 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PML87_RS15145 (PML87_15145) | 139..1002 | + | 864 | WP_001284311.1 | zeta toxin family protein | Toxin |
PML87_RS15150 (PML87_15150) | 1265..2002 | - | 738 | WP_001038796.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
PML87_RS15155 (PML87_15155) | 2127..2210 | - | 84 | WP_033602770.1 | 23S rRNA methyltransferase attenuator leader peptide ErmL | - |
PML87_RS15160 (PML87_15160) | 2769..3857 | - | 1089 | WP_231415007.1 | MobV family relaxase | - |
PML87_RS15165 (PML87_15165) | 4341..4484 | + | 144 | WP_002360221.1 | hypothetical protein | - |
PML87_RS15170 (PML87_15170) | 4738..6165 | + | 1428 | WP_131648054.1 | chloramphenicol/florfenicol efflux MFS transporter FexA | - |
PML87_RS15175 (PML87_15175) | 6343..6759 | + | 417 | WP_000855243.1 | NAD(P)H-dependent oxidoreductase | - |
PML87_RS15180 (PML87_15180) | 6901..7311 | + | 411 | WP_218210702.1 | hypothetical protein | - |
PML87_RS15185 (PML87_15185) | 7470..9383 | + | 1914 | WP_272019623.1 | ABC-F type ribosomal protection protein OptrA | - |
PML87_RS15190 (PML87_15190) | 9639..11219 | + | 1581 | WP_125276230.1 | IS21 family transposase | - |
PML87_RS15195 (PML87_15195) | 11374..11646 | + | 273 | WP_011266100.1 | helix-turn-helix transcriptional regulator | - |
PML87_RS15200 (PML87_15200) | 12030..13520 | + | 1491 | WP_001025003.1 | primase C-terminal domain-containing protein | - |
PML87_RS15205 (PML87_15205) | 13868..14038 | + | 171 | WP_000713594.1 | hypothetical protein | - |
PML87_RS15210 (PML87_15210) | 14052..14669 | + | 618 | WP_001062589.1 | recombinase family protein | - |
PML87_RS15215 (PML87_15215) | 14669..16813 | + | 2145 | WP_000108741.1 | type IA DNA topoisomerase | - |
PML87_RS15220 (PML87_15220) | 16916..17812 | + | 897 | WP_001835294.1 | ParA family protein | - |
PML87_RS15225 (PML87_15225) | 17904..18119 | + | 216 | WP_001835296.1 | peptide-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | erm(B) / fexA / optrA | - | 1..18271 | 18271 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32404.02 Da Isoelectric Point: 6.9964
>T268816 WP_001284311.1 NZ_CP116512:139-1002 [Enterococcus gallinarum]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 1GVN | |
PDB | 3Q8X |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829F0A3 |