Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
| Location | 334627..335158 | Replicon | chromosome |
| Accession | NZ_CP116496 | ||
| Organism | MAG: Rickettsia asembonensis isolate Perak | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PG979_RS02025 | Protein ID | WP_277360794.1 |
| Coordinates | 334877..335158 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | A0A0C2LZV4 |
| Locus tag | PG979_RS02020 | Protein ID | WP_041078435.1 |
| Coordinates | 334627..334890 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG979_RS01990 (PG979_000395) | 329967..330290 | + | 324 | WP_011271665.1 | YbaB/EbfC family nucleoid-associated protein | - |
| PG979_RS01995 (PG979_000396) | 330413..331108 | - | 696 | WP_277360790.1 | TIGR02281 family clan AA aspartic protease | - |
| PG979_RS02000 (PG979_000397) | 331247..332242 | - | 996 | WP_277360791.1 | serine hydrolase domain-containing protein | - |
| PG979_RS02005 (PG979_000398) | 332399..333121 | - | 723 | WP_041078429.1 | amino acid ABC transporter ATP-binding protein | - |
| PG979_RS02010 (PG979_000399) | 333125..333889 | - | 765 | WP_277360792.1 | MBL fold metallo-hydrolase | - |
| PG979_RS02015 (PG979_000400) | 333904..334566 | + | 663 | WP_277360793.1 | phosphatase PAP2 family protein | - |
| PG979_RS02020 (PG979_000401) | 334627..334890 | + | 264 | WP_041078435.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PG979_RS02025 (PG979_000402) | 334877..335158 | + | 282 | WP_277360794.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| PG979_RS02030 (PG979_000403) | 335353..336435 | + | 1083 | WP_041078439.1 | LptF/LptG family permease | - |
| PG979_RS02035 (PG979_000404) | 336577..337041 | - | 465 | WP_041078441.1 | DNA polymerase III subunit chi | - |
| PG979_RS02040 (PG979_000405) | 337182..337775 | - | 594 | WP_241773682.1 | hypothetical protein | - |
| PG979_RS02050 (PG979_000406) | 338110..339276 | - | 1167 | WP_277360795.1 | succinyl-diaminopimelate desuccinylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11041.95 Da Isoelectric Point: 10.2545
>T268812 WP_277360794.1 NZ_CP116496:334877-335158 [Rickettsia asembonensis]
MRTIKRTAQFKRDYKREKRRKHVINLDDILLKAVKYLIADTTLPVNMRDHALIGNWKDCRDCHIKPDLVLIYRKPDADTL
ELIRLGSHNELGF
MRTIKRTAQFKRDYKREKRRKHVINLDDILLKAVKYLIADTTLPVNMRDHALIGNWKDCRDCHIKPDLVLIYRKPDADTL
ELIRLGSHNELGF
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|