Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 108725..109284 | Replicon | chromosome |
| Accession | NZ_CP116496 | ||
| Organism | MAG: Rickettsia asembonensis isolate Perak | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PG979_RS00780 | Protein ID | WP_277360678.1 |
| Coordinates | 108725..109054 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | PG979_RS00785 | Protein ID | WP_041078961.1 |
| Coordinates | 109048..109284 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG979_RS00760 | 105637..105915 | - | 279 | WP_199402805.1 | transposase | - |
| PG979_RS00765 | 105909..106431 | + | 523 | Protein_115 | transposase | - |
| PG979_RS00770 (PG979_000157) | 106582..107514 | - | 933 | WP_277360676.1 | transposase | - |
| PG979_RS00775 (PG979_000158) | 107902..108483 | + | 582 | WP_277360677.1 | hypothetical protein | - |
| PG979_RS00780 (PG979_000159) | 108725..109054 | - | 330 | WP_277360678.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PG979_RS00785 (PG979_000160) | 109048..109284 | - | 237 | WP_041078961.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PG979_RS00790 (PG979_000161) | 109360..110703 | - | 1344 | WP_041078960.1 | ribosome biogenesis GTPase Der | - |
| PG979_RS00795 (PG979_000162) | 110706..110971 | - | 266 | Protein_121 | SemiSWEET family sugar transporter | - |
| PG979_RS00800 (PG979_000163) | 111176..111958 | - | 783 | WP_041078958.1 | exodeoxyribonuclease III | - |
| PG979_RS00805 (PG979_000164) | 111955..112947 | - | 993 | WP_277360679.1 | hypothetical protein | - |
| PG979_RS00810 (PG979_000165) | 113092..113526 | - | 435 | WP_277360680.1 | transporter substrate-binding domain-containing protein | - |
| PG979_RS00815 | 113660..113749 | + | 90 | WP_277360996.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 105909..106172 | 263 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12582.01 Da Isoelectric Point: 10.0532
>T268811 WP_277360678.1 NZ_CP116496:c109054-108725 [Rickettsia asembonensis]
MVNYIPEKGDIVWLDFEPQKGKEIQKTRPAVVLSPYKYHLKSGLALFAPITSQIKNYPFEVIIDFQQIKGAVLCDQVRSM
DFKARKANKILTLNKILIDEIIHKLKLLL
MVNYIPEKGDIVWLDFEPQKGKEIQKTRPAVVLSPYKYHLKSGLALFAPITSQIKNYPFEVIIDFQQIKGAVLCDQVRSM
DFKARKANKILTLNKILIDEIIHKLKLLL
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|