Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 31065..31708 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP116494 | ||
| Organism | Klebsiella pneumoniae strain XY05-03 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | PIB23_RS29360 | Protein ID | WP_001044770.1 |
| Coordinates | 31065..31481 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | PIB23_RS29365 | Protein ID | WP_001261282.1 |
| Coordinates | 31478..31708 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB23_RS29340 (27168) | 27168..27440 | - | 273 | Protein_34 | transposase | - |
| PIB23_RS29350 (28422) | 28422..29444 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
| PIB23_RS29355 (29429) | 29429..30991 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
| PIB23_RS29360 (31065) | 31065..31481 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PIB23_RS29365 (31478) | 31478..31708 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PIB23_RS29370 (31665) | 31665..32126 | + | 462 | WP_014343465.1 | hypothetical protein | - |
| PIB23_RS29375 (32287) | 32287..33231 | + | 945 | WP_011977810.1 | hypothetical protein | - |
| PIB23_RS29380 (33268) | 33268..33660 | + | 393 | WP_011977811.1 | hypothetical protein | - |
| PIB23_RS29385 (33718) | 33718..34239 | + | 522 | WP_013214008.1 | hypothetical protein | - |
| PIB23_RS29390 (34285) | 34285..34488 | + | 204 | WP_011977813.1 | hypothetical protein | - |
| PIB23_RS29395 (34518) | 34518..35522 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
| PIB23_RS29400 (35706) | 35706..36485 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaSHV-12 / blaKPC-2 / blaCTX-M-65 | - | 1..85083 | 85083 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T268806 WP_001044770.1 NZ_CP116494:c31481-31065 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |