Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 76393..76973 | Replicon | plasmid unnamed2 |
Accession | NZ_CP116493 | ||
Organism | Klebsiella pneumoniae strain XY05-03 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | PIB23_RS29045 | Protein ID | WP_071177730.1 |
Coordinates | 76393..76707 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | PIB23_RS29050 | Protein ID | WP_000093040.1 |
Coordinates | 76695..76973 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB23_RS29015 (PIB23_29015) | 72074..72958 | - | 885 | WP_000058717.1 | EamA family transporter | - |
PIB23_RS29020 (PIB23_29020) | 73096..73488 | - | 393 | WP_001351729.1 | isochorismatase family cysteine hydrolase | - |
PIB23_RS29025 (PIB23_29025) | 73492..75243 | + | 1752 | Protein_81 | Tn3-like element TnAs1 family transposase | - |
PIB23_RS29030 (PIB23_29030) | 75303..75569 | + | 267 | WP_228733412.1 | hypothetical protein | - |
PIB23_RS29035 (PIB23_29035) | 75596..75775 | - | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
PIB23_RS29040 (PIB23_29040) | 75801..76229 | - | 429 | WP_001140599.1 | hypothetical protein | - |
PIB23_RS29045 (PIB23_29045) | 76393..76707 | - | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PIB23_RS29050 (PIB23_29050) | 76695..76973 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PIB23_RS29055 (PIB23_29055) | 77148..77513 | - | 366 | WP_072354022.1 | TonB family protein | - |
PIB23_RS29060 (PIB23_29060) | 77510..77881 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
PIB23_RS29065 (PIB23_29065) | 78155..78400 | - | 246 | WP_032440458.1 | hypothetical protein | - |
PIB23_RS29070 (PIB23_29070) | 79045..80532 | + | 1488 | WP_004178082.1 | group II intron reverse transcriptase/maturase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | dfrA14 / sul2 / tet(A) / blaLAP-2 / qnrS1 | - | 1..100630 | 100630 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T268805 WP_071177730.1 NZ_CP116493:c76707-76393 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|