Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 158528..159438 Replicon plasmid unnamed1
Accession NZ_CP116492
Organism Klebsiella pneumoniae strain XY05-03

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag PIB23_RS28290 Protein ID WP_004026354.1
Coordinates 158968..159438 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag PIB23_RS28285 Protein ID WP_004026357.1
Coordinates 158528..158971 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB23_RS28255 (PIB23_28255) 153563..153964 + 402 WP_214588034.1 LuxR C-terminal-related transcriptional regulator -
PIB23_RS28260 (PIB23_28260) 154037..154939 + 903 WP_004213613.1 DMT family inner membrane transporter PEG344 -
PIB23_RS28265 (PIB23_28265) 155082..155303 - 222 WP_004213615.1 hypothetical protein -
PIB23_RS28270 (PIB23_28270) 155365..156672 - 1308 Protein_167 FepA family TonB-dependent siderophore receptor -
PIB23_RS28275 (PIB23_28275) 156738..157718 + 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
PIB23_RS28280 (PIB23_28280) 157924..158427 + 504 Protein_169 DUF4113 domain-containing protein -
PIB23_RS28285 (PIB23_28285) 158528..158971 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
PIB23_RS28290 (PIB23_28290) 158968..159438 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
PIB23_RS28295 (PIB23_28295) 159587..160284 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
PIB23_RS28300 (PIB23_28300) 161670..162320 - 651 WP_068893702.1 DUF1173 family protein -
PIB23_RS28305 (PIB23_28305) 162353..162619 - 267 WP_223175074.1 DUF1173 family protein -
PIB23_RS28310 (PIB23_28310) 162797..163291 + 495 WP_004212794.1 thermonuclease family protein -
PIB23_RS28315 (PIB23_28315) 163628..164026 + 399 WP_004212796.1 H-NS family nucleoid-associated regulatory protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN 1..218592 218592
- inside IScluster/Tn - - 156738..165477 8739


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T268803 WP_004026354.1 NZ_CP116492:158968-159438 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT268803 WP_004026357.1 NZ_CP116492:158528-158971 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References