Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 119895..120565 Replicon plasmid unnamed1
Accession NZ_CP116492
Organism Klebsiella pneumoniae strain XY05-03

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag PIB23_RS28050 Protein ID WP_004213072.1
Coordinates 120122..120565 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag PIB23_RS28045 Protein ID WP_004213073.1
Coordinates 119895..120125 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB23_RS28020 (PIB23_28020) 115080..115859 - 780 WP_004213560.1 site-specific integrase -
PIB23_RS28025 (PIB23_28025) 115856..116677 - 822 WP_004213562.1 hypothetical protein -
PIB23_RS28030 (PIB23_28030) 117649..117855 + 207 WP_004213077.1 hypothetical protein -
PIB23_RS28035 (PIB23_28035) 117845..118138 - 294 WP_004213076.1 hypothetical protein -
PIB23_RS28040 (PIB23_28040) 118154..119287 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
PIB23_RS28045 (PIB23_28045) 119895..120125 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PIB23_RS28050 (PIB23_28050) 120122..120565 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
PIB23_RS28055 (PIB23_28055) 120714..120965 + 252 WP_186987481.1 hypothetical protein -
PIB23_RS28060 (PIB23_28060) 120988..121292 - 305 Protein_125 transposase -
PIB23_RS28065 (PIB23_28065) 121709..122344 + 636 Protein_126 mucoid phenotype regulator RmpA2 -
PIB23_RS28070 (PIB23_28070) 122862..123265 - 404 Protein_127 GAF domain-containing protein -
PIB23_RS28075 (PIB23_28075) 123356..124276 - 921 WP_004213934.1 DUF1471 domain-containing protein -
PIB23_RS28080 (PIB23_28080) 124325..124816 - 492 WP_011251327.1 DM13 domain-containing protein -
PIB23_RS28085 (PIB23_28085) 124879..125154 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN 1..218592 218592


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T268802 WP_004213072.1 NZ_CP116492:120122-120565 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT268802 WP_004213073.1 NZ_CP116492:119895-120125 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References