Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 119895..120565 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP116492 | ||
| Organism | Klebsiella pneumoniae strain XY05-03 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | PIB23_RS28050 | Protein ID | WP_004213072.1 |
| Coordinates | 120122..120565 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | PIB23_RS28045 | Protein ID | WP_004213073.1 |
| Coordinates | 119895..120125 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB23_RS28020 (PIB23_28020) | 115080..115859 | - | 780 | WP_004213560.1 | site-specific integrase | - |
| PIB23_RS28025 (PIB23_28025) | 115856..116677 | - | 822 | WP_004213562.1 | hypothetical protein | - |
| PIB23_RS28030 (PIB23_28030) | 117649..117855 | + | 207 | WP_004213077.1 | hypothetical protein | - |
| PIB23_RS28035 (PIB23_28035) | 117845..118138 | - | 294 | WP_004213076.1 | hypothetical protein | - |
| PIB23_RS28040 (PIB23_28040) | 118154..119287 | - | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| PIB23_RS28045 (PIB23_28045) | 119895..120125 | + | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PIB23_RS28050 (PIB23_28050) | 120122..120565 | + | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PIB23_RS28055 (PIB23_28055) | 120714..120965 | + | 252 | WP_186987481.1 | hypothetical protein | - |
| PIB23_RS28060 (PIB23_28060) | 120988..121292 | - | 305 | Protein_125 | transposase | - |
| PIB23_RS28065 (PIB23_28065) | 121709..122344 | + | 636 | Protein_126 | mucoid phenotype regulator RmpA2 | - |
| PIB23_RS28070 (PIB23_28070) | 122862..123265 | - | 404 | Protein_127 | GAF domain-containing protein | - |
| PIB23_RS28075 (PIB23_28075) | 123356..124276 | - | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| PIB23_RS28080 (PIB23_28080) | 124325..124816 | - | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| PIB23_RS28085 (PIB23_28085) | 124879..125154 | - | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN | 1..218592 | 218592 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T268802 WP_004213072.1 NZ_CP116492:120122-120565 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|