Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4247478..4248097 Replicon chromosome
Accession NZ_CP116491
Organism Klebsiella pneumoniae strain XY05-03

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag PIB23_RS21325 Protein ID WP_002892050.1
Coordinates 4247879..4248097 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag PIB23_RS21320 Protein ID WP_002892066.1
Coordinates 4247478..4247852 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB23_RS21310 (PIB23_21310) 4242630..4243823 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PIB23_RS21315 (PIB23_21315) 4243846..4246992 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
PIB23_RS21320 (PIB23_21320) 4247478..4247852 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
PIB23_RS21325 (PIB23_21325) 4247879..4248097 + 219 WP_002892050.1 HHA domain-containing protein Toxin
PIB23_RS21330 (PIB23_21330) 4248256..4248822 + 567 WP_002892030.1 maltose O-acetyltransferase -
PIB23_RS21335 (PIB23_21335) 4248794..4248934 - 141 WP_004147370.1 hypothetical protein -
PIB23_RS21340 (PIB23_21340) 4248955..4249425 + 471 WP_002892026.1 YlaC family protein -
PIB23_RS21345 (PIB23_21345) 4249400..4250851 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
PIB23_RS21350 (PIB23_21350) 4250952..4251650 + 699 WP_002892021.1 GNAT family protein -
PIB23_RS21355 (PIB23_21355) 4251647..4251787 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
PIB23_RS21360 (PIB23_21360) 4251787..4252050 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T268797 WP_002892050.1 NZ_CP116491:4247879-4248097 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT268797 WP_002892066.1 NZ_CP116491:4247478-4247852 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References