Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4247478..4248097 | Replicon | chromosome |
Accession | NZ_CP116491 | ||
Organism | Klebsiella pneumoniae strain XY05-03 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | PIB23_RS21325 | Protein ID | WP_002892050.1 |
Coordinates | 4247879..4248097 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | PIB23_RS21320 | Protein ID | WP_002892066.1 |
Coordinates | 4247478..4247852 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB23_RS21310 (PIB23_21310) | 4242630..4243823 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PIB23_RS21315 (PIB23_21315) | 4243846..4246992 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
PIB23_RS21320 (PIB23_21320) | 4247478..4247852 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
PIB23_RS21325 (PIB23_21325) | 4247879..4248097 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
PIB23_RS21330 (PIB23_21330) | 4248256..4248822 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
PIB23_RS21335 (PIB23_21335) | 4248794..4248934 | - | 141 | WP_004147370.1 | hypothetical protein | - |
PIB23_RS21340 (PIB23_21340) | 4248955..4249425 | + | 471 | WP_002892026.1 | YlaC family protein | - |
PIB23_RS21345 (PIB23_21345) | 4249400..4250851 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
PIB23_RS21350 (PIB23_21350) | 4250952..4251650 | + | 699 | WP_002892021.1 | GNAT family protein | - |
PIB23_RS21355 (PIB23_21355) | 4251647..4251787 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
PIB23_RS21360 (PIB23_21360) | 4251787..4252050 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T268797 WP_002892050.1 NZ_CP116491:4247879-4248097 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT268797 WP_002892066.1 NZ_CP116491:4247478-4247852 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |