Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 1014475..1015009 | Replicon | chromosome |
Accession | NZ_CP116490 | ||
Organism | Haemophilus influenzae strain 93P10H1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2R3GCN3 |
Locus tag | BV187_RS05040 | Protein ID | WP_005651512.1 |
Coordinates | 1014475..1014765 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | E7A5Y2 |
Locus tag | BV187_RS05045 | Protein ID | WP_005651514.1 |
Coordinates | 1014755..1015009 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BV187_RS05015 (BV187_1016) | 1011677..1012180 | + | 504 | WP_005659127.1 | LPS assembly lipoprotein LptE | - |
BV187_RS05020 (BV187_1017) | 1012180..1013214 | + | 1035 | WP_005659128.1 | DNA polymerase III subunit delta | - |
BV187_RS05025 (BV187_1018) | 1013393..1013695 | + | 303 | WP_272524418.1 | hypothetical protein | - |
BV187_RS05030 (BV187_1019) | 1013878..1014015 | - | 138 | WP_005659136.1 | hypothetical protein | - |
BV187_RS05035 (BV187_1021) | 1014185..1014439 | - | 255 | WP_014551014.1 | hypothetical protein | - |
BV187_RS05040 (BV187_1022) | 1014475..1014765 | - | 291 | WP_005651512.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BV187_RS05045 (BV187_1023) | 1014755..1015009 | - | 255 | WP_005651514.1 | stability protein StbD | Antitoxin |
BV187_RS05050 (BV187_1024) | 1015307..1015531 | - | 225 | WP_005659141.1 | hypothetical protein | - |
BV187_RS05055 (BV187_1025) | 1015531..1015839 | - | 309 | WP_005659142.1 | P2 family phage major capsid protein | - |
BV187_RS05060 (BV187_1026) | 1015869..1016408 | - | 540 | WP_005659144.1 | hypothetical protein | - |
BV187_RS05070 (BV187_1028) | 1016770..1018836 | - | 2067 | WP_005686190.1 | glycine--tRNA ligase subunit beta | - |
BV187_RS05075 (BV187_1029) | 1019174..1019539 | - | 366 | WP_005686191.1 | endonuclease domain-containing protein | - |
BV187_RS05080 (BV187_1030) | 1019569..1019829 | - | 261 | WP_005663579.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11482.41 Da Isoelectric Point: 10.6484
>T268784 WP_005651512.1 NZ_CP116490:c1014765-1014475 [Haemophilus influenzae]
MTYKLIFDKRALKEWNKLGETLRQQFKNKLAERMINPRIQADKLKGENDLYKIKLRSAGYRLVYQVRDQEITIIVVSVGK
RERLEVYKTAEQRTAH
MTYKLIFDKRALKEWNKLGETLRQQFKNKLAERMINPRIQADKLKGENDLYKIKLRSAGYRLVYQVRDQEITIIVVSVGK
RERLEVYKTAEQRTAH
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2R3GCN3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5C2QYX4 |