Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | toxTA/Tad-couple_hipB |
| Location | 721157..721805 | Replicon | chromosome |
| Accession | NZ_CP116490 | ||
| Organism | Haemophilus influenzae strain 93P10H1 | ||
Toxin (Protein)
| Gene name | toxT | Uniprot ID | A0A0Y7JUP0 |
| Locus tag | BV187_RS03590 | Protein ID | WP_005694481.1 |
| Coordinates | 721446..721805 (-) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | BV187_RS03585 | Protein ID | WP_005650837.1 |
| Coordinates | 721157..721453 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BV187_RS03560 (BV187_0724) | 716431..717189 | - | 759 | WP_012054646.1 | DUF3800 domain-containing protein | - |
| BV187_RS03565 (BV187_0725) | 717201..718007 | - | 807 | WP_012054645.1 | shikimate dehydrogenase | - |
| BV187_RS03570 (BV187_0726) | 718011..718562 | - | 552 | WP_012054644.1 | Sua5/YciO/YrdC/YwlC family protein | - |
| BV187_RS03575 (BV187_0727) | 718578..719114 | - | 537 | WP_012054643.1 | type I DNA topoisomerase | - |
| BV187_RS03580 (BV187_0728) | 719124..721040 | - | 1917 | WP_012054642.1 | ABC transporter ATP-binding protein | - |
| BV187_RS03585 (BV187_0729) | 721157..721453 | - | 297 | WP_005650837.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| BV187_RS03590 (BV187_0730) | 721446..721805 | - | 360 | WP_005694481.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| BV187_RS03595 (BV187_0731) | 722075..725194 | - | 3120 | Protein_665 | TonB-dependent hemoglobin/transferrin/lactoferrin family receptor | - |
| BV187_RS03600 | 725152..725310 | - | 159 | WP_272524520.1 | PT domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 14321.67 Da Isoelectric Point: 10.1408
>T268781 WP_005694481.1 NZ_CP116490:c721805-721446 [Haemophilus influenzae]
MYEILFYRDQNDIEPVKEYLLSLAQNESKDSRIKLNKIRDYVKLLSELGTSVGKPYVKHLDGEIWELRPIRDRILFARLM
DGRFVLLHQFMKKTQKTPKREIQTAQQRLSELKERLKNE
MYEILFYRDQNDIEPVKEYLLSLAQNESKDSRIKLNKIRDYVKLLSELGTSVGKPYVKHLDGEIWELRPIRDRILFARLM
DGRFVLLHQFMKKTQKTPKREIQTAQQRLSELKERLKNE
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|