Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 400080..400717 | Replicon | chromosome |
Accession | NZ_CP116490 | ||
Organism | Haemophilus influenzae strain 93P10H1 |
Toxin (Protein)
Gene name | VapC1 | Uniprot ID | A0A0Y7JDC3 |
Locus tag | BV187_RS01910 | Protein ID | WP_005659980.1 |
Coordinates | 400313..400717 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | VapB1 | Uniprot ID | A0A0H3PN67 |
Locus tag | BV187_RS01905 | Protein ID | WP_005656316.1 |
Coordinates | 400080..400316 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BV187_RS01880 | 395288..395569 | + | 282 | Protein_337 | hypothetical protein | - |
BV187_RS01885 (BV187_0387) | 395772..396644 | - | 873 | WP_048954586.1 | hypothetical protein | - |
BV187_RS01890 (BV187_0388) | 396706..398472 | - | 1767 | WP_011961734.1 | aspartate--tRNA ligase | - |
BV187_RS01895 (BV187_0389) | 398691..399209 | + | 519 | WP_005649040.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
BV187_RS01900 (BV187_0390) | 399262..399987 | + | 726 | WP_005669008.1 | carboxy-S-adenosyl-L-methionine synthase CmoA | - |
BV187_RS01905 (BV187_0391) | 400080..400316 | + | 237 | WP_005656316.1 | antitoxin | Antitoxin |
BV187_RS01910 (BV187_0392) | 400313..400717 | + | 405 | WP_005659980.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
BV187_RS01915 (BV187_0393) | 400784..401191 | + | 408 | WP_005654069.1 | lactoylglutathione lyase | - |
BV187_RS01920 (BV187_0394) | 401265..401954 | + | 690 | WP_005686760.1 | ribonuclease T | - |
BV187_RS01925 (BV187_0395) | 402270..403622 | + | 1353 | WP_005686762.1 | Na+/H+ antiporter family protein | - |
BV187_RS01930 (BV187_0396) | 403654..404238 | + | 585 | WP_005686764.1 | primosomal replication protein | - |
BV187_RS01940 (BV187_0398) | 404590..405156 | - | 567 | WP_005544066.1 | elongation factor P | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15660.23 Da Isoelectric Point: 8.9777
>T268779 WP_005659980.1 NZ_CP116490:400313-400717 [Haemophilus influenzae]
MIYMLDTNIIIYLMKNRPKIVAERVSQLLPNDRLVISFITYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
MIYMLDTNIIIYLMKNRPKIVAERVSQLLPNDRLVISFITYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Y7JDC3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3PN67 |