Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1043406..1044037 | Replicon | chromosome |
Accession | NZ_CP116489 | ||
Organism | Haemophilus influenzae strain 93P28H1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q4QLW0 |
Locus tag | BV189_RS05195 | Protein ID | WP_005651560.1 |
Coordinates | 1043406..1043804 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q4QLV9 |
Locus tag | BV189_RS05200 | Protein ID | WP_005648011.1 |
Coordinates | 1043804..1044037 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BV189_RS05175 (BV189_1052) | 1038590..1039708 | + | 1119 | WP_005686201.1 | bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD | - |
BV189_RS05180 (BV189_1053) | 1039709..1040731 | + | 1023 | WP_005651554.1 | outer membrane-stress sensor serine endopeptidase DegS | - |
BV189_RS05185 (BV189_1054) | 1040805..1041620 | - | 816 | WP_012054544.1 | DNA-formamidopyrimidine glycosylase | - |
BV189_RS05190 (BV189_1055) | 1041851..1043386 | - | 1536 | WP_012054543.1 | L-2,4-diaminobutyrate decarboxylase | - |
BV189_RS05195 (BV189_1056) | 1043406..1043804 | - | 399 | WP_005651560.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
BV189_RS05200 (BV189_1057) | 1043804..1044037 | - | 234 | WP_005648011.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
BV189_RS05205 (BV189_1058) | 1044184..1045548 | - | 1365 | WP_005664172.1 | diaminobutyrate--2-oxoglutarate transaminase | - |
BV189_RS05210 (BV189_1059) | 1045895..1046065 | - | 171 | WP_005613503.1 | 50S ribosomal protein L33 | - |
BV189_RS05215 (BV189_1060) | 1046077..1046313 | - | 237 | WP_005542826.1 | 50S ribosomal protein L28 | - |
BV189_RS05220 (BV189_1061) | 1046526..1047191 | - | 666 | WP_041174703.1 | DNA repair protein RadC | - |
BV189_RS05225 (BV189_1062) | 1047355..1048557 | + | 1203 | WP_012054541.1 | bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15115.46 Da Isoelectric Point: 8.0514
>T268776 WP_005651560.1 NZ_CP116489:c1043804-1043406 [Haemophilus influenzae]
VLKYMLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEKSEYPERNIAVIEDFLSRLTILDYQPKHAAHF
GNIKAELSKQGKLIGENDIHIAAHARSEGLILVSNNLREFERVIALRTENWV
VLKYMLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEKSEYPERNIAVIEDFLSRLTILDYQPKHAAHF
GNIKAELSKQGKLIGENDIHIAAHARSEGLILVSNNLREFERVIALRTENWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q4QLW0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806DGS0 |