Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 783937..784541 | Replicon | chromosome |
Accession | NZ_CP116489 | ||
Organism | Haemophilus influenzae strain 93P28H1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A112W1Q1 |
Locus tag | BV189_RS03880 | Protein ID | WP_005661261.1 |
Coordinates | 784233..784541 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0Y7JSS2 |
Locus tag | BV189_RS03875 | Protein ID | WP_005661259.1 |
Coordinates | 783937..784233 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BV189_RS03860 (BV189_0788) | 779703..781088 | + | 1386 | WP_012054619.1 | L-seryl-tRNA(Sec) selenium transferase | - |
BV189_RS03865 (BV189_0789) | 781085..782944 | + | 1860 | WP_012054618.1 | selenocysteine-specific translation elongation factor | - |
BV189_RS03870 (BV189_0790) | 782963..783817 | + | 855 | WP_005687862.1 | DUF3298 domain-containing protein | - |
BV189_RS03875 (BV189_0791) | 783937..784233 | + | 297 | WP_005661259.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
BV189_RS03880 (BV189_0792) | 784233..784541 | + | 309 | WP_005661261.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
BV189_RS03885 (BV189_0793) | 784597..787964 | - | 3368 | Protein_722 | TonB-dependent hemoglobin/transferrin/lactoferrin family receptor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11895.63 Da Isoelectric Point: 7.3189
>T268774 WP_005661261.1 NZ_CP116489:784233-784541 [Haemophilus influenzae]
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIHCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYV
IQDEFDELKFSRLNTHSQTALK
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIHCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYV
IQDEFDELKFSRLNTHSQTALK
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A112W1Q1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Y7JSS2 |