Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 400084..400721 | Replicon | chromosome |
Accession | NZ_CP116489 | ||
Organism | Haemophilus influenzae strain 93P28H1 |
Toxin (Protein)
Gene name | VapC1 | Uniprot ID | A0A0Y7JDC3 |
Locus tag | BV189_RS01915 | Protein ID | WP_005659980.1 |
Coordinates | 400317..400721 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | VapB1 | Uniprot ID | A0A0H3PN67 |
Locus tag | BV189_RS01910 | Protein ID | WP_005656316.1 |
Coordinates | 400084..400320 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BV189_RS01885 | 395292..395573 | + | 282 | Protein_338 | hypothetical protein | - |
BV189_RS01890 (BV189_0390) | 395776..396648 | - | 873 | WP_048954586.1 | hypothetical protein | - |
BV189_RS01895 (BV189_0391) | 396710..398476 | - | 1767 | WP_011961734.1 | aspartate--tRNA ligase | - |
BV189_RS01900 (BV189_0392) | 398695..399213 | + | 519 | WP_005649040.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
BV189_RS01905 (BV189_0393) | 399266..399991 | + | 726 | WP_005669008.1 | carboxy-S-adenosyl-L-methionine synthase CmoA | - |
BV189_RS01910 (BV189_0394) | 400084..400320 | + | 237 | WP_005656316.1 | antitoxin | Antitoxin |
BV189_RS01915 (BV189_0395) | 400317..400721 | + | 405 | WP_005659980.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
BV189_RS01920 (BV189_0396) | 400788..401195 | + | 408 | WP_005654069.1 | lactoylglutathione lyase | - |
BV189_RS01925 (BV189_0397) | 401269..401958 | + | 690 | WP_005686760.1 | ribonuclease T | - |
BV189_RS01930 (BV189_0398) | 402274..403626 | + | 1353 | WP_005686762.1 | Na+/H+ antiporter family protein | - |
BV189_RS01935 (BV189_0399) | 403658..404242 | + | 585 | WP_005686764.1 | primosomal replication protein | - |
BV189_RS01945 (BV189_0401) | 404594..405160 | - | 567 | WP_005544066.1 | elongation factor P | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15660.23 Da Isoelectric Point: 8.9777
>T268770 WP_005659980.1 NZ_CP116489:400317-400721 [Haemophilus influenzae]
MIYMLDTNIIIYLMKNRPKIVAERVSQLLPNDRLVISFITYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
MIYMLDTNIIIYLMKNRPKIVAERVSQLLPNDRLVISFITYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Y7JDC3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3PN67 |