Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 107084..107727 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP116481 | ||
| Organism | Escherichia coli strain GTEN_24 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | E5Q65_RS23930 | Protein ID | WP_001044768.1 |
| Coordinates | 107311..107727 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | E5Q65_RS23925 | Protein ID | WP_001261287.1 |
| Coordinates | 107084..107314 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5Q65_RS23915 (102262) | 102262..103395 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
| E5Q65_RS23920 (103658) | 103658..106777 | - | 3120 | WP_023909028.1 | hypothetical protein | - |
| E5Q65_RS23925 (107084) | 107084..107314 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| E5Q65_RS23930 (107311) | 107311..107727 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| E5Q65_RS23935 (107889) | 107889..108896 | - | 1008 | Protein_131 | AAA family ATPase | - |
| E5Q65_RS23940 (108959) | 108959..109663 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| E5Q65_RS23945 (109716) | 109716..109940 | + | 225 | Protein_133 | DDE-type integrase/transposase/recombinase | - |
| E5Q65_RS23950 (110126) | 110126..111109 | + | 984 | WP_113962661.1 | IS481 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / catA1 / sul1 / qacE / aadA2 / dfrA12 / qepA4 / mph(A) / erm(B) / msr(E) / mph(E) / qnrB4 / blaDHA-1 | - | 1..138420 | 138420 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T268766 WP_001044768.1 NZ_CP116481:107311-107727 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |