Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1730585..1731210 | Replicon | chromosome |
| Accession | NZ_CP116480 | ||
| Organism | Escherichia coli strain GTEN_24 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | E5Q65_RS08435 | Protein ID | WP_000911329.1 |
| Coordinates | 1730585..1730983 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | E5Q65_RS08440 | Protein ID | WP_000450524.1 |
| Coordinates | 1730983..1731210 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5Q65_RS08415 (1726463) | 1726463..1726663 | + | 201 | WP_000383836.1 | YpfN family protein | - |
| E5Q65_RS08420 (1726773) | 1726773..1727471 | - | 699 | WP_000679823.1 | esterase | - |
| E5Q65_RS08425 (1727545) | 1727545..1729560 | - | 2016 | WP_000829294.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| E5Q65_RS08430 (1729575) | 1729575..1730438 | - | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| E5Q65_RS08435 (1730585) | 1730585..1730983 | - | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| E5Q65_RS08440 (1730983) | 1730983..1731210 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| E5Q65_RS08445 (1731364) | 1731364..1732077 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| E5Q65_RS08450 (1732290) | 1732290..1733324 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| E5Q65_RS08455 (1733341) | 1733341..1734219 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| E5Q65_RS08460 (1734365) | 1734365..1734937 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| E5Q65_RS08465 (1734937) | 1734937..1735407 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T268749 WP_000911329.1 NZ_CP116480:c1730983-1730585 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XW84 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |