Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1224259..1225090 | Replicon | chromosome |
Accession | NZ_CP116480 | ||
Organism | Escherichia coli strain GTEN_24 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | F4THW6 |
Locus tag | E5Q65_RS06145 | Protein ID | WP_000854818.1 |
Coordinates | 1224716..1225090 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | F4THW5 |
Locus tag | E5Q65_RS06140 | Protein ID | WP_001313071.1 |
Coordinates | 1224259..1224627 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5Q65_RS06105 (1219485) | 1219485..1220555 | + | 1071 | WP_000102643.1 | patatin-like phospholipase family protein | - |
E5Q65_RS06110 (1220691) | 1220691..1221374 | + | 684 | WP_042004735.1 | hypothetical protein | - |
E5Q65_RS06115 (1221390) | 1221390..1221800 | + | 411 | WP_000846713.1 | hypothetical protein | - |
E5Q65_RS06120 (1222021) | 1222021..1222842 | + | 822 | WP_001234530.1 | DUF932 domain-containing protein | - |
E5Q65_RS06125 (1222924) | 1222924..1223403 | + | 480 | WP_000860076.1 | antirestriction protein | - |
E5Q65_RS06130 (1223419) | 1223419..1223895 | + | 477 | WP_001186726.1 | RadC family protein | - |
E5Q65_RS06135 (1223958) | 1223958..1224179 | + | 222 | WP_000692301.1 | DUF987 domain-containing protein | - |
E5Q65_RS06140 (1224259) | 1224259..1224627 | + | 369 | WP_001313071.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
E5Q65_RS06145 (1224716) | 1224716..1225090 | + | 375 | WP_000854818.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
E5Q65_RS06150 (1225087) | 1225087..1225281 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
E5Q65_RS06155 (1225327) | 1225327..1225407 | + | 81 | Protein_1207 | hypothetical protein | - |
E5Q65_RS06160 (1225616) | 1225616..1227157 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
E5Q65_RS06165 (1227172) | 1227172..1227918 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
E5Q65_RS06170 (1228282) | 1228282..1228362 | - | 81 | WP_023441679.1 | hypothetical protein | - |
E5Q65_RS06175 (1228341) | 1228341..1228664 | + | 324 | WP_223216378.1 | EutP/PduV family microcompartment system protein | - |
E5Q65_RS06180 (1228765) | 1228765..1229094 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13972.98 Da Isoelectric Point: 7.1333
>T268747 WP_000854818.1 NZ_CP116480:1224716-1225090 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13498.23 Da Isoelectric Point: 5.8696
>AT268747 WP_001313071.1 NZ_CP116480:1224259-1224627 [Escherichia coli]
VSDTLSGTTHPDDNNSHPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
VSDTLSGTTHPDDNNSHPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3W3PHA3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M1L2Z3 |