Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PfiT-PfiA/ParE-Phd |
| Location | 43900..44514 | Replicon | plasmid p |
| Accession | NZ_CP116479 | ||
| Organism | Pseudomonas syringae pv. actinidiae strain PSA.AH.01 | ||
Toxin (Protein)
| Gene name | PfiT | Uniprot ID | A0A2V0R8Y7 |
| Locus tag | PHA47_RS29700 | Protein ID | WP_017685123.1 |
| Coordinates | 43900..44250 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | PfiA | Uniprot ID | S6SUK0 |
| Locus tag | PHA47_RS29705 | Protein ID | WP_017685122.1 |
| Coordinates | 44266..44514 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA47_RS29675 (PHA47_29675) | 39017..40387 | - | 1371 | WP_017684943.1 | TrbI/VirB10 family protein | - |
| PHA47_RS29680 (PHA47_29680) | 40374..41183 | - | 810 | WP_017684942.1 | P-type conjugative transfer protein VirB9 | - |
| PHA47_RS29685 (PHA47_29685) | 41173..41478 | - | 306 | WP_017706770.1 | type IV secretion system protein | - |
| PHA47_RS29690 (PHA47_29690) | 41566..43144 | + | 1579 | WP_076612065.1 | IS3-like element ISPsy31 family transposase | - |
| PHA47_RS29695 (PHA47_29695) | 43232..43768 | + | 537 | WP_225877707.1 | helix-turn-helix transcriptional regulator | - |
| PHA47_RS29700 (PHA47_29700) | 43900..44250 | - | 351 | WP_017685123.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PHA47_RS29705 (PHA47_29705) | 44266..44514 | - | 249 | WP_017685122.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| PHA47_RS29710 (PHA47_29710) | 44855..45817 | + | 963 | WP_017685121.1 | tyrosine-type recombinase/integrase | - |
| PHA47_RS29715 (PHA47_29715) | 46015..46230 | - | 216 | Protein_48 | IS630 family transposase | - |
| PHA47_RS29720 (PHA47_29720) | 46262..47839 | - | 1578 | Protein_49 | IS3-like element ISPsy31 family transposase | - |
| PHA47_RS29725 (PHA47_29725) | 47887..48749 | - | 863 | Protein_50 | IS630-like element ISPsy32 family transposase | - |
| PHA47_RS29730 (PHA47_29730) | 48855..49325 | + | 471 | WP_237243125.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..77260 | 77260 | |
| - | inside | IScluster/Tn | - | - | 41635..59327 | 17692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13012.89 Da Isoelectric Point: 4.1953
>T268740 WP_017685123.1 NZ_CP116479:c44250-43900 [Pseudomonas syringae pv. actinidiae]
MNTFALRFTDVAQQSLEDQVEHLAVTQGFSSAAQRIDILIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMQSVDIDEIVISLVLGGKQSVEQALIRYCLLQPI
MNTFALRFTDVAQQSLEDQVEHLAVTQGFSSAAQRIDILIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMQSVDIDEIVISLVLGGKQSVEQALIRYCLLQPI
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2V0R8Y7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2V0R8I6 |