Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PfiT-PfiA/ParE-Phd
Location 43900..44514 Replicon plasmid p
Accession NZ_CP116479
Organism Pseudomonas syringae pv. actinidiae strain PSA.AH.01

Toxin (Protein)


Gene name PfiT Uniprot ID A0A2V0R8Y7
Locus tag PHA47_RS29700 Protein ID WP_017685123.1
Coordinates 43900..44250 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name PfiA Uniprot ID S6SUK0
Locus tag PHA47_RS29705 Protein ID WP_017685122.1
Coordinates 44266..44514 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PHA47_RS29675 (PHA47_29675) 39017..40387 - 1371 WP_017684943.1 TrbI/VirB10 family protein -
PHA47_RS29680 (PHA47_29680) 40374..41183 - 810 WP_017684942.1 P-type conjugative transfer protein VirB9 -
PHA47_RS29685 (PHA47_29685) 41173..41478 - 306 WP_017706770.1 type IV secretion system protein -
PHA47_RS29690 (PHA47_29690) 41566..43144 + 1579 WP_076612065.1 IS3-like element ISPsy31 family transposase -
PHA47_RS29695 (PHA47_29695) 43232..43768 + 537 WP_225877707.1 helix-turn-helix transcriptional regulator -
PHA47_RS29700 (PHA47_29700) 43900..44250 - 351 WP_017685123.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PHA47_RS29705 (PHA47_29705) 44266..44514 - 249 WP_017685122.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
PHA47_RS29710 (PHA47_29710) 44855..45817 + 963 WP_017685121.1 tyrosine-type recombinase/integrase -
PHA47_RS29715 (PHA47_29715) 46015..46230 - 216 Protein_48 IS630 family transposase -
PHA47_RS29720 (PHA47_29720) 46262..47839 - 1578 Protein_49 IS3-like element ISPsy31 family transposase -
PHA47_RS29725 (PHA47_29725) 47887..48749 - 863 Protein_50 IS630-like element ISPsy32 family transposase -
PHA47_RS29730 (PHA47_29730) 48855..49325 + 471 WP_237243125.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..77260 77260
- inside IScluster/Tn - - 41635..59327 17692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-101)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13012.89 Da        Isoelectric Point: 4.1953

>T268740 WP_017685123.1 NZ_CP116479:c44250-43900 [Pseudomonas syringae pv. actinidiae]
MNTFALRFTDVAQQSLEDQVEHLAVTQGFSSAAQRIDILIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMQSVDIDEIVISLVLGGKQSVEQALIRYCLLQPI

Download         Length: 351 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9389.72 Da        Isoelectric Point: 9.5019

>AT268740 WP_017685122.1 NZ_CP116479:c44514-44266 [Pseudomonas syringae pv. actinidiae]
MRVETISYLKRNAADLPLDEPLVVTQNGVPAYVVESYADRKRRDESIALVKLLAISSREYAQGKHCSTDELKARLSRRFD
HK

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2V0R8Y7

Antitoxin

Source ID Structure
AlphaFold DB A0A2V0R8I6

References