Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 6266932..6267451 Replicon chromosome
Accession NZ_CP116478
Organism Pseudomonas syringae pv. actinidiae strain PSA.AH.01

Toxin (Protein)


Gene name relE Uniprot ID S6W9N2
Locus tag PHA47_RS28290 Protein ID WP_017684310.1
Coordinates 6266932..6267222 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID S6UWW5
Locus tag PHA47_RS28295 Protein ID WP_002551444.1
Coordinates 6267212..6267451 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PHA47_RS28255 (PHA47_28255) 6263262..6263804 + 543 WP_017684306.1 hypothetical protein -
PHA47_RS28260 (PHA47_28260) 6263868..6264115 - 248 Protein_5572 type II toxin-antitoxin system RelE/ParE family toxin -
PHA47_RS28265 (PHA47_28265) 6264141..6264383 - 243 WP_017684307.1 hypothetical protein -
PHA47_RS28270 (PHA47_28270) 6264564..6265178 - 615 WP_017684308.1 histidine phosphatase family protein -
PHA47_RS28275 (PHA47_28275) 6265271..6265612 - 342 WP_003380754.1 DUF5713 family protein -
PHA47_RS28280 (PHA47_28280) 6265969..6266706 + 738 WP_017684309.1 hypothetical protein -
PHA47_RS28285 (PHA47_28285) 6266728..6266847 - 120 Protein_5577 GNAT family N-acetyltransferase -
PHA47_RS28290 (PHA47_28290) 6266932..6267222 - 291 WP_017684310.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PHA47_RS28295 (PHA47_28295) 6267212..6267451 - 240 WP_002551444.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PHA47_RS28300 (PHA47_28300) 6267627..6268088 - 462 WP_017684311.1 GNAT family N-acetyltransferase -
PHA47_RS28305 (PHA47_28305) 6268175..6268744 - 570 WP_017684312.1 GNAT family N-acetyltransferase -
PHA47_RS28310 (PHA47_28310) 6268905..6269399 + 495 WP_005621707.1 hypothetical protein -
PHA47_RS28315 (PHA47_28315) 6269672..6270019 + 348 WP_017684314.1 helix-turn-helix transcriptional regulator -
PHA47_RS28320 (PHA47_28320) 6270105..6271379 - 1275 WP_003380766.1 OprD family porin -
PHA47_RS28325 (PHA47_28325) 6271609..6271815 - 207 WP_044392902.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-81)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-64)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11145.98 Da        Isoelectric Point: 10.0984

>T268739 WP_017684310.1 NZ_CP116478:c6267222-6266932 [Pseudomonas syringae pv. actinidiae]
MTYSLEFDARALKEWHKLGDTVRQQLKKKLATILVAPRVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
RERDEVYRKAADRLGG

Download         Length: 291 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8955.34 Da        Isoelectric Point: 4.6017

>AT268739 WP_002551444.1 NZ_CP116478:c6267451-6267212 [Pseudomonas syringae pv. actinidiae]
MASINVRIDDDLKARAYLELEKLGVTPSELLRQTLQYVAERGQLPFKTVLMTEEDEALLATVRERLAAPQRVKVSLDDL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K8M1I3

Antitoxin

Source ID Structure
AlphaFold DB A0A0K8M1G9

References