Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 6266932..6267451 | Replicon | chromosome |
| Accession | NZ_CP116478 | ||
| Organism | Pseudomonas syringae pv. actinidiae strain PSA.AH.01 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S6W9N2 |
| Locus tag | PHA47_RS28290 | Protein ID | WP_017684310.1 |
| Coordinates | 6266932..6267222 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S6UWW5 |
| Locus tag | PHA47_RS28295 | Protein ID | WP_002551444.1 |
| Coordinates | 6267212..6267451 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA47_RS28255 (PHA47_28255) | 6263262..6263804 | + | 543 | WP_017684306.1 | hypothetical protein | - |
| PHA47_RS28260 (PHA47_28260) | 6263868..6264115 | - | 248 | Protein_5572 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PHA47_RS28265 (PHA47_28265) | 6264141..6264383 | - | 243 | WP_017684307.1 | hypothetical protein | - |
| PHA47_RS28270 (PHA47_28270) | 6264564..6265178 | - | 615 | WP_017684308.1 | histidine phosphatase family protein | - |
| PHA47_RS28275 (PHA47_28275) | 6265271..6265612 | - | 342 | WP_003380754.1 | DUF5713 family protein | - |
| PHA47_RS28280 (PHA47_28280) | 6265969..6266706 | + | 738 | WP_017684309.1 | hypothetical protein | - |
| PHA47_RS28285 (PHA47_28285) | 6266728..6266847 | - | 120 | Protein_5577 | GNAT family N-acetyltransferase | - |
| PHA47_RS28290 (PHA47_28290) | 6266932..6267222 | - | 291 | WP_017684310.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PHA47_RS28295 (PHA47_28295) | 6267212..6267451 | - | 240 | WP_002551444.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PHA47_RS28300 (PHA47_28300) | 6267627..6268088 | - | 462 | WP_017684311.1 | GNAT family N-acetyltransferase | - |
| PHA47_RS28305 (PHA47_28305) | 6268175..6268744 | - | 570 | WP_017684312.1 | GNAT family N-acetyltransferase | - |
| PHA47_RS28310 (PHA47_28310) | 6268905..6269399 | + | 495 | WP_005621707.1 | hypothetical protein | - |
| PHA47_RS28315 (PHA47_28315) | 6269672..6270019 | + | 348 | WP_017684314.1 | helix-turn-helix transcriptional regulator | - |
| PHA47_RS28320 (PHA47_28320) | 6270105..6271379 | - | 1275 | WP_003380766.1 | OprD family porin | - |
| PHA47_RS28325 (PHA47_28325) | 6271609..6271815 | - | 207 | WP_044392902.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11145.98 Da Isoelectric Point: 10.0984
>T268739 WP_017684310.1 NZ_CP116478:c6267222-6266932 [Pseudomonas syringae pv. actinidiae]
MTYSLEFDARALKEWHKLGDTVRQQLKKKLATILVAPRVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
RERDEVYRKAADRLGG
MTYSLEFDARALKEWHKLGDTVRQQLKKKLATILVAPRVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
RERDEVYRKAADRLGG
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K8M1I3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K8M1G9 |