Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 5650238..5650911 | Replicon | chromosome |
Accession | NZ_CP116478 | ||
Organism | Pseudomonas syringae pv. actinidiae strain PSA.AH.01 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A2V0QPW6 |
Locus tag | PHA47_RS25210 | Protein ID | WP_017684243.1 |
Coordinates | 5650492..5650911 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q48B52 |
Locus tag | PHA47_RS25205 | Protein ID | WP_003381346.1 |
Coordinates | 5650238..5650495 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHA47_RS25185 (PHA47_25185) | 5646440..5646634 | - | 195 | WP_017684246.1 | hypothetical protein | - |
PHA47_RS25190 (PHA47_25190) | 5647192..5648124 | + | 933 | WP_020308919.1 | XopAH/AvrB family type III secretion system effector | - |
PHA47_RS25195 (PHA47_25195) | 5648933..5649187 | - | 255 | WP_003381350.1 | hypothetical protein | - |
PHA47_RS25200 (PHA47_25200) | 5649235..5649891 | - | 657 | WP_017684244.1 | hypothetical protein | - |
PHA47_RS25205 (PHA47_25205) | 5650238..5650495 | + | 258 | WP_003381346.1 | Arc family DNA-binding protein | Antitoxin |
PHA47_RS25210 (PHA47_25210) | 5650492..5650911 | + | 420 | WP_017684243.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PHA47_RS25215 (PHA47_25215) | 5650952..5651585 | + | 634 | Protein_4980 | recombinase family protein | - |
PHA47_RS25220 (PHA47_25220) | 5651860..5652795 | + | 936 | WP_017704392.1 | AvrD family protein | - |
PHA47_RS25225 (PHA47_25225) | 5653136..5653783 | + | 648 | WP_017703697.1 | histidine phosphatase family protein | - |
PHA47_RS25230 (PHA47_25230) | 5654022..5654849 | + | 828 | WP_003381339.1 | TauD/TfdA family dioxygenase | - |
PHA47_RS25235 (PHA47_25235) | 5654867..5655901 | + | 1035 | WP_017684240.1 | sulfotransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 5616466..5652795 | 36329 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15152.46 Da Isoelectric Point: 4.7010
>T268737 WP_017684243.1 NZ_CP116478:5650492-5650911 [Pseudomonas syringae pv. actinidiae]
MILLDTNVISEPQRREPNAHVLDWIDAQALETLYLSTITVAELRAGIALMPVGKRQDSLRENLEKHLLPMFANRVLSFDM
TCTKAYAELLAKSRAAGLAIETADAFIAAIALANGFTVATRDTGPFEAAGLNVINPWEA
MILLDTNVISEPQRREPNAHVLDWIDAQALETLYLSTITVAELRAGIALMPVGKRQDSLRENLEKHLLPMFANRVLSFDM
TCTKAYAELLAKSRAAGLAIETADAFIAAIALANGFTVATRDTGPFEAAGLNVINPWEA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2V0QPW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q48B52 |