Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1718012..1718537 | Replicon | chromosome |
| Accession | NZ_CP116478 | ||
| Organism | Pseudomonas syringae pv. actinidiae strain PSA.AH.01 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0K8M609 |
| Locus tag | PHA47_RS07760 | Protein ID | WP_017684329.1 |
| Coordinates | 1718012..1718302 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0K8M645 |
| Locus tag | PHA47_RS07765 | Protein ID | WP_017684328.1 |
| Coordinates | 1718292..1718537 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA47_RS07745 (PHA47_07745) | 1713284..1713754 | - | 471 | WP_003382605.1 | MaoC family dehydratase | - |
| PHA47_RS07750 (PHA47_07750) | 1714150..1715838 | + | 1689 | WP_017684330.1 | long-chain-fatty-acid--CoA ligase FadD2 | - |
| PHA47_RS07755 (PHA47_07755) | 1716194..1717885 | + | 1692 | WP_003382607.1 | long-chain-fatty-acid--CoA ligase FadD1 | - |
| PHA47_RS07760 (PHA47_07760) | 1718012..1718302 | - | 291 | WP_017684329.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PHA47_RS07765 (PHA47_07765) | 1718292..1718537 | - | 246 | WP_017684328.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PHA47_RS07770 (PHA47_07770) | 1718710..1722621 | + | 3912 | WP_020365655.1 | ATP-dependent RNA helicase HrpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11019.86 Da Isoelectric Point: 10.4180
>T268736 WP_017684329.1 NZ_CP116478:c1718302-1718012 [Pseudomonas syringae pv. actinidiae]
MTFKLEFLPSALKEWKKLGHTVSAQLKKKLLERLELPRNAGDALHGMPDHYKIKLRSAGYRLVYRVEDDRVVVTVVAVGK
RERGDIYDSAKDRLSP
MTFKLEFLPSALKEWKKLGHTVSAQLKKKLLERLELPRNAGDALHGMPDHYKIKLRSAGYRLVYRVEDDRVVVTVVAVGK
RERGDIYDSAKDRLSP
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K8M609 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K8M645 |