Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 1161300..1161841 | Replicon | chromosome |
Accession | NZ_CP116478 | ||
Organism | Pseudomonas syringae pv. actinidiae strain PSA.AH.01 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0K8LVV5 |
Locus tag | PHA47_RS05190 | Protein ID | WP_017683357.1 |
Coordinates | 1161300..1161575 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0K8LU58 |
Locus tag | PHA47_RS05195 | Protein ID | WP_003382249.1 |
Coordinates | 1161575..1161841 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHA47_RS05170 (PHA47_05170) | 1156425..1157456 | - | 1032 | WP_020312848.1 | TRAP transporter substrate-binding protein | - |
PHA47_RS05175 (PHA47_05175) | 1157513..1158397 | - | 885 | WP_003380378.1 | SMP-30/gluconolactonase/LRE family protein | - |
PHA47_RS05180 (PHA47_05180) | 1158457..1159281 | - | 825 | WP_003380380.1 | NAD(P)-dependent oxidoreductase | - |
PHA47_RS05185 (PHA47_05185) | 1159460..1160728 | - | 1269 | WP_007244158.1 | OprD family porin | - |
PHA47_RS05190 (PHA47_05190) | 1161300..1161575 | - | 276 | WP_017683357.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PHA47_RS05195 (PHA47_05195) | 1161575..1161841 | - | 267 | WP_003382249.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PHA47_RS05200 (PHA47_05200) | 1162006..1163928 | - | 1923 | WP_017683359.1 | methyl-accepting chemotaxis protein | - |
PHA47_RS05205 (PHA47_05205) | 1164287..1166167 | + | 1881 | WP_003382247.1 | methyl-accepting chemotaxis protein | - |
PHA47_RS05210 (PHA47_05210) | 1166295..1166558 | - | 264 | WP_017683360.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1151894..1161841 | 9947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10770.41 Da Isoelectric Point: 7.0123
>T268735 WP_017683357.1 NZ_CP116478:c1161575-1161300 [Pseudomonas syringae pv. actinidiae]
MELMWTSKTLSDVTRLYDFLAVANQPAAAQTAQKLTAAPIMLLSNPRIGERLEEFEPRDVRRIQIGRYEMRYEIVDSTIY
LLRLWHTREDR
MELMWTSKTLSDVTRLYDFLAVANQPAAAQTAQKLTAAPIMLLSNPRIGERLEEFEPRDVRRIQIGRYEMRYEIVDSTIY
LLRLWHTREDR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K8LVV5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K8LU58 |