Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 1151894..1152528 Replicon chromosome
Accession NZ_CP116478
Organism Pseudomonas syringae pv. actinidiae strain PSA.AH.01

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PHA47_RS05140 Protein ID WP_003380365.1
Coordinates 1151894..1152298 (-) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID Q888H8
Locus tag PHA47_RS05145 Protein ID WP_003380366.1
Coordinates 1152298..1152528 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PHA47_RS05105 (PHA47_05105) 1147327..1147809 + 483 WP_003380358.1 PAS domain-containing protein -
PHA47_RS05110 (PHA47_05110) 1147905..1149161 + 1257 WP_003380359.1 3-phosphoshikimate 1-carboxyvinyltransferase -
PHA47_RS05115 (PHA47_05115) 1149226..1149462 + 237 WP_003380360.1 hypothetical protein -
PHA47_RS05120 (PHA47_05120) 1149538..1150200 - 663 WP_003380361.1 ChrR family anti-sigma-E factor -
PHA47_RS05125 (PHA47_05125) 1150200..1150712 - 513 WP_003380362.1 sigma-70 family RNA polymerase sigma factor -
PHA47_RS05130 (PHA47_05130) 1150948..1151136 - 189 WP_003380363.1 hypothetical protein -
PHA47_RS05135 (PHA47_05135) 1151135..1151710 + 576 WP_003380364.1 hypothetical protein -
PHA47_RS05140 (PHA47_05140) 1151894..1152298 - 405 WP_003380365.1 tRNA(fMet)-specific endonuclease VapC Toxin
PHA47_RS05145 (PHA47_05145) 1152298..1152528 - 231 WP_003380366.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PHA47_RS05150 (PHA47_05150) 1152643..1153524 - 882 WP_003380368.1 aldose 1-epimerase -
PHA47_RS05155 (PHA47_05155) 1153499..1154469 - 971 Protein_1018 DMT family transporter -
PHA47_RS05160 (PHA47_05160) 1154553..1155833 - 1281 WP_003380372.1 TRAP transporter large permease -
PHA47_RS05165 (PHA47_05165) 1155834..1156361 - 528 WP_003380373.1 TRAP transporter small permease -
PHA47_RS05170 (PHA47_05170) 1156425..1157456 - 1032 WP_020312848.1 TRAP transporter substrate-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1151894..1161841 9947


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(7-34)


Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 14814.09 Da        Isoelectric Point: 6.8615

>T268734 WP_003380365.1 NZ_CP116478:c1152298-1151894 [Pseudomonas syringae pv. actinidiae]
MLKYMLDTNICIFTIKNKPVSVREAFNLHHGQLCISAITLMELVYGAEKSSSPERNLAVVEGFAARLELLPYDSAAAAHT
GMIRAELARAGTPIGPYDQMIAGHARSLGLVVITNNQREFQRVEGLRVEDWVSQ

Download         Length: 405 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8593.67 Da        Isoelectric Point: 4.5557

>AT268734 WP_003380366.1 NZ_CP116478:c1152528-1152298 [Pseudomonas syringae pv. actinidiae]
MEQSTVFKSNRSQAVRLPKAVALPDDVKRVDVVAVGRTRIISPAGEMWNSWFDGESVSDDFMAEREQPVEQLRESL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0K8LU44

References