Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 4265981..4266516 | Replicon | chromosome |
| Accession | NZ_CP116477 | ||
| Organism | Pectobacterium sp. A5351 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | O1Q74_RS19655 | Protein ID | WP_271875157.1 |
| Coordinates | 4266229..4266516 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q6DB37 |
| Locus tag | O1Q74_RS19650 | Protein ID | WP_010281712.1 |
| Coordinates | 4265981..4266232 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1Q74_RS19635 (O1Q74_19635) | 4262605..4263639 | + | 1035 | WP_271875152.1 | putative FMN-dependent luciferase-like monooxygenase | - |
| O1Q74_RS19640 (O1Q74_19640) | 4263636..4264769 | + | 1134 | WP_271875153.1 | alkylhydroperoxidase domain protein | - |
| O1Q74_RS19645 (O1Q74_19645) | 4264820..4265725 | - | 906 | WP_271875154.1 | siderophore-interacting protein | - |
| O1Q74_RS19650 (O1Q74_19650) | 4265981..4266232 | + | 252 | WP_010281712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| O1Q74_RS19655 (O1Q74_19655) | 4266229..4266516 | + | 288 | WP_271875157.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O1Q74_RS19660 (O1Q74_19660) | 4266611..4267963 | - | 1353 | WP_271875158.1 | glutathione-disulfide reductase | - |
| O1Q74_RS19665 (O1Q74_19665) | 4268092..4268934 | - | 843 | WP_271875159.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
| O1Q74_RS19670 (O1Q74_19670) | 4269336..4269629 | + | 294 | WP_271875161.1 | DUF2623 family protein | - |
| O1Q74_RS19675 (O1Q74_19675) | 4269639..4270460 | - | 822 | WP_271875163.1 | energy transducer TonB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11088.14 Da Isoelectric Point: 10.3856
>T268732 WP_271875157.1 NZ_CP116477:4266229-4266516 [Pectobacterium sp. A5351]
MSYSVKFREDALKEWLKLDKTIQQQFAKKLKKCCENPHIPSAKLRGMKDCYRIKLRASGFRLVYEVIDDVLVIAVVAVGK
RERSGVYHLASERMR
MSYSVKFREDALKEWLKLDKTIQQQFAKKLKKCCENPHIPSAKLRGMKDCYRIKLRASGFRLVYEVIDDVLVIAVVAVGK
RERSGVYHLASERMR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|