Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
| Location | 3506464..3507206 | Replicon | chromosome |
| Accession | NZ_CP116477 | ||
| Organism | Pectobacterium sp. A5351 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | O1Q74_RS16185 | Protein ID | WP_271874631.1 |
| Coordinates | 3506464..3506943 (-) | Length | 160 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A6P1S083 |
| Locus tag | O1Q74_RS16190 | Protein ID | WP_039481848.1 |
| Coordinates | 3506934..3507206 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O1Q74_RS16155 (O1Q74_16155) | 3502215..3502502 | - | 288 | WP_271874629.1 | RnfH family protein | - |
| O1Q74_RS16160 (O1Q74_16160) | 3502483..3502929 | - | 447 | WP_271874630.1 | type II toxin-antitoxin system RatA family toxin | - |
| O1Q74_RS16165 (O1Q74_16165) | 3503085..3503567 | + | 483 | WP_012773422.1 | SsrA-binding protein SmpB | - |
| O1Q74_RS16175 (O1Q74_16175) | 3504093..3504958 | + | 866 | Protein_3136 | IS3 family transposase | - |
| O1Q74_RS16180 (O1Q74_16180) | 3504968..3506179 | - | 1212 | Protein_3137 | IS3 family transposase | - |
| O1Q74_RS16185 (O1Q74_16185) | 3506464..3506943 | - | 480 | WP_271874631.1 | GNAT family N-acetyltransferase | Toxin |
| O1Q74_RS16190 (O1Q74_16190) | 3506934..3507206 | - | 273 | WP_039481848.1 | DUF1778 domain-containing protein | Antitoxin |
| O1Q74_RS16195 (O1Q74_16195) | 3507505..3507681 | + | 177 | WP_271874632.1 | hypothetical protein | - |
| O1Q74_RS16200 (O1Q74_16200) | 3508082..3508306 | + | 225 | Protein_3141 | transposase | - |
| O1Q74_RS16205 (O1Q74_16205) | 3509014..3509214 | + | 201 | WP_271874633.1 | hypothetical protein | - |
| O1Q74_RS16210 (O1Q74_16210) | 3509290..3509862 | - | 573 | WP_271874634.1 | TetR/AcrR family transcriptional regulator | - |
| O1Q74_RS16215 (O1Q74_16215) | 3510362..3510457 | + | 96 | Protein_3144 | SDR family oxidoreductase | - |
| O1Q74_RS16220 (O1Q74_16220) | 3510520..3511626 | + | 1107 | WP_271874635.1 | NADH:flavin oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3499646..3509214 | 9568 | |
| - | inside | IScluster/Tn | - | - | 3504968..3508357 | 3389 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 160 a.a. Molecular weight: 17486.18 Da Isoelectric Point: 9.5963
>T268730 WP_271874631.1 NZ_CP116477:c3506943-3506464 [Pectobacterium sp. A5351]
VGITAPELLLPQHAVVDFRSSEPSLDDWLKRKALKNQTIGASRTFIVCESGANQVIGFYALATGSVQRQSVSGALRRNMP
DPLPVLVLGRLAVDERYQRRGIGAGLLKDAILRSRQVAEQVGTKALLVHALSEEAKDFYLHWGFTPSEIQPSTLLLPLW
VGITAPELLLPQHAVVDFRSSEPSLDDWLKRKALKNQTIGASRTFIVCESGANQVIGFYALATGSVQRQSVSGALRRNMP
DPLPVLVLGRLAVDERYQRRGIGAGLLKDAILRSRQVAEQVGTKALLVHALSEEAKDFYLHWGFTPSEIQPSTLLLPLW
Download Length: 480 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|