Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3161064..3161689 | Replicon | chromosome |
Accession | NZ_CP116477 | ||
Organism | Pectobacterium sp. A5351 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | C6DB72 |
Locus tag | O1Q74_RS14655 | Protein ID | WP_005976087.1 |
Coordinates | 3161486..3161689 (+) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | O1Q74_RS14650 | Protein ID | WP_271874138.1 |
Coordinates | 3161064..3161432 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O1Q74_RS14635 (O1Q74_14635) | 3158297..3159772 | - | 1476 | Protein_2837 | IS1182 family transposase | - |
O1Q74_RS14640 (O1Q74_14640) | 3160059..3160307 | + | 249 | WP_271874133.1 | type B 50S ribosomal protein L31 | - |
O1Q74_RS14645 (O1Q74_14645) | 3160325..3160468 | + | 144 | WP_005976091.1 | type B 50S ribosomal protein L36 | - |
O1Q74_RS14650 (O1Q74_14650) | 3161064..3161432 | + | 369 | WP_271874138.1 | Hha toxicity modulator TomB | Antitoxin |
O1Q74_RS14655 (O1Q74_14655) | 3161486..3161689 | + | 204 | WP_005976087.1 | HHA domain-containing protein | Toxin |
O1Q74_RS14665 (O1Q74_14665) | 3162425..3162745 | + | 321 | WP_271874142.1 | MGMT family protein | - |
O1Q74_RS14670 (O1Q74_14670) | 3162766..3163338 | - | 573 | WP_271874143.1 | YbaY family lipoprotein | - |
O1Q74_RS14675 (O1Q74_14675) | 3163551..3164414 | + | 864 | WP_271874145.1 | acyl-CoA thioesterase II | - |
O1Q74_RS14680 (O1Q74_14680) | 3164492..3165778 | - | 1287 | WP_271874146.1 | ammonium transporter AmtB | - |
O1Q74_RS14685 (O1Q74_14685) | 3165818..3166156 | - | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8145.52 Da Isoelectric Point: 8.9008
>T268727 WP_005976087.1 NZ_CP116477:3161486-3161689 [Pectobacterium sp. A5351]
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13979.72 Da Isoelectric Point: 4.3689
>AT268727 WP_271874138.1 NZ_CP116477:3161064-3161432 [Pectobacterium sp. A5351]
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINLQLNELIEHIATFILTFKIKYPNESELSEQVEKYL
DDTYVLFSNYGINDAELRCWQKSKAKLFGMFSGENVCTPAKT
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINLQLNELIEHIATFILTFKIKYPNESELSEQVEKYL
DDTYVLFSNYGINDAELRCWQKSKAKLFGMFSGENVCTPAKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|